Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1Y1XJG9

Protein Details
Accession A0A1Y1XJG9    Localization Confidence Medium Confidence Score 13.4
NoLS Segment(s)
PositionSequenceProtein Nature
4-32FEMIYNPNRNRNRNRNHNRNCNSNRNRNLHydrophilic
NLS Segment(s)
PositionSequence
39-49NHKRLLGQKKR
Subcellular Location(s) nucl 20, cyto_nucl 12, mito 5
Family & Domain DBs
Amino Acid Sequences MDAFEMIYNPNRNRNRNRNHNRNCNSNRNRNLNHNRNRNHKRLLGQKKRKYLIFKESSPYKFTYGVCMGDRDEYHIVF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.68
2 0.72
3 0.76
4 0.85
5 0.86
6 0.89
7 0.92
8 0.86
9 0.87
10 0.84
11 0.83
12 0.81
13 0.8
14 0.78
15 0.76
16 0.74
17 0.73
18 0.77
19 0.76
20 0.77
21 0.76
22 0.73
23 0.75
24 0.79
25 0.74
26 0.69
27 0.63
28 0.59
29 0.6
30 0.66
31 0.66
32 0.7
33 0.72
34 0.75
35 0.75
36 0.74
37 0.71
38 0.66
39 0.65
40 0.61
41 0.56
42 0.54
43 0.58
44 0.56
45 0.52
46 0.48
47 0.4
48 0.37
49 0.35
50 0.35
51 0.3
52 0.31
53 0.29
54 0.29
55 0.27
56 0.28
57 0.28
58 0.26