Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y1X395

Protein Details
Accession A0A1Y1X395    Localization Confidence Medium Confidence Score 12.2
NoLS Segment(s)
PositionSequenceProtein Nature
239-273CTDETQSLKKSKNKNKNKNKNKNKRRFLNFLNGCCHydrophilic
NLS Segment(s)
PositionSequence
247-264KKSKNKNKNKNKNKNKRR
Subcellular Location(s) nucl 16, cyto_nucl 11, cyto 4, pero 3, mito 1, plas 1, E.R. 1, golg 1
Family & Domain DBs
InterPro View protein in InterPro  
IPR038595  LOR_sf  
Amino Acid Sequences MDFNYLYQKRLDNNLKNEIAVFNGNYCCLRETCFTIHDDILSSINGGFSIIGENRRFRGNFQNLNISLKAHNNIPIFYLQNYLLQDIKKVYSNEKQNNVPFAEIKQCALGAYLIKFKNIATNETDYFEMISDYNFQICNIFYSNHQKLDKSSVVCQILRNGDCCDVYIASGVDHVFMLGLASFFFCRDIFINNNEEVKIDIDNDNNNNNYNDNLSSMTPLVNNDVLKSQYNTYTRINYCTDETQSLKKSKNKNKNKNKNKNKRRFLNFLNGCCCGLLL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.61
2 0.59
3 0.56
4 0.53
5 0.43
6 0.36
7 0.3
8 0.23
9 0.18
10 0.18
11 0.19
12 0.18
13 0.19
14 0.19
15 0.17
16 0.2
17 0.19
18 0.24
19 0.26
20 0.27
21 0.28
22 0.29
23 0.29
24 0.26
25 0.24
26 0.2
27 0.17
28 0.15
29 0.13
30 0.1
31 0.1
32 0.09
33 0.07
34 0.06
35 0.05
36 0.08
37 0.1
38 0.15
39 0.17
40 0.2
41 0.21
42 0.27
43 0.27
44 0.27
45 0.36
46 0.4
47 0.45
48 0.46
49 0.54
50 0.49
51 0.53
52 0.5
53 0.41
54 0.34
55 0.3
56 0.28
57 0.2
58 0.25
59 0.22
60 0.22
61 0.22
62 0.22
63 0.2
64 0.19
65 0.2
66 0.14
67 0.17
68 0.17
69 0.17
70 0.17
71 0.16
72 0.17
73 0.16
74 0.17
75 0.18
76 0.19
77 0.22
78 0.27
79 0.37
80 0.42
81 0.45
82 0.5
83 0.48
84 0.51
85 0.46
86 0.4
87 0.31
88 0.26
89 0.27
90 0.22
91 0.2
92 0.16
93 0.15
94 0.14
95 0.13
96 0.12
97 0.07
98 0.08
99 0.14
100 0.14
101 0.14
102 0.15
103 0.14
104 0.19
105 0.19
106 0.19
107 0.16
108 0.19
109 0.2
110 0.21
111 0.21
112 0.16
113 0.15
114 0.13
115 0.1
116 0.07
117 0.06
118 0.07
119 0.07
120 0.07
121 0.07
122 0.07
123 0.07
124 0.07
125 0.08
126 0.08
127 0.08
128 0.1
129 0.18
130 0.2
131 0.25
132 0.26
133 0.25
134 0.25
135 0.31
136 0.32
137 0.26
138 0.26
139 0.26
140 0.28
141 0.29
142 0.28
143 0.25
144 0.27
145 0.25
146 0.24
147 0.2
148 0.19
149 0.18
150 0.18
151 0.16
152 0.11
153 0.1
154 0.1
155 0.08
156 0.06
157 0.07
158 0.07
159 0.06
160 0.06
161 0.05
162 0.04
163 0.04
164 0.04
165 0.03
166 0.03
167 0.03
168 0.04
169 0.04
170 0.04
171 0.05
172 0.05
173 0.07
174 0.07
175 0.11
176 0.13
177 0.16
178 0.19
179 0.2
180 0.21
181 0.2
182 0.19
183 0.17
184 0.15
185 0.13
186 0.12
187 0.12
188 0.12
189 0.16
190 0.18
191 0.2
192 0.2
193 0.22
194 0.21
195 0.2
196 0.19
197 0.17
198 0.15
199 0.13
200 0.14
201 0.13
202 0.14
203 0.13
204 0.13
205 0.12
206 0.12
207 0.14
208 0.15
209 0.15
210 0.14
211 0.16
212 0.17
213 0.19
214 0.21
215 0.2
216 0.24
217 0.26
218 0.29
219 0.3
220 0.36
221 0.36
222 0.38
223 0.39
224 0.34
225 0.36
226 0.36
227 0.36
228 0.33
229 0.34
230 0.37
231 0.42
232 0.46
233 0.49
234 0.53
235 0.6
236 0.66
237 0.74
238 0.78
239 0.82
240 0.87
241 0.91
242 0.95
243 0.96
244 0.96
245 0.97
246 0.97
247 0.97
248 0.96
249 0.95
250 0.92
251 0.9
252 0.86
253 0.86
254 0.83
255 0.79
256 0.74
257 0.66
258 0.58