Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y1XNI2

Protein Details
Accession A0A1Y1XNI2   
Localization Confidence Medium
Confidence Score 11
NoLS Segment(s)
PositionSequenceProtein Nature
199-221YDENREKEEKKRKMKINISRIIVHydrophilic
NLS Segment(s)
PositionSequence
208-210KKR
Subcellular Location(s) nucl 8E.R. 8, cyto 4, pero 2, golg 2, mito 1, extr 1, vacu 1
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MFIKNIFYYLLLNLIIYINLIKSEKFLYSNHTLSSLSKYEHFKWSCDEDRECGDETFCNYFENGNICVLGVYICKEDENSKCIFIDTYDYNTNTDETRYNSHNKEKLIFKSCDKVNVDAKICETEQCTKDTDCLSGVCYSNSCIAEKPIYVCSDISVNDEKMGMNCKKQNQMKCISNSDCYSDNCEESGYCGIRIKEDYDENREKEEKKRKMKINISRIIVGVALTLAIIFFIVSICIFKKCKCILLGPIKVENK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.11
2 0.1
3 0.09
4 0.09
5 0.06
6 0.09
7 0.1
8 0.09
9 0.11
10 0.13
11 0.15
12 0.16
13 0.17
14 0.22
15 0.28
16 0.3
17 0.29
18 0.28
19 0.27
20 0.26
21 0.31
22 0.27
23 0.22
24 0.26
25 0.31
26 0.32
27 0.41
28 0.41
29 0.37
30 0.39
31 0.45
32 0.47
33 0.47
34 0.46
35 0.39
36 0.42
37 0.43
38 0.4
39 0.33
40 0.26
41 0.22
42 0.23
43 0.23
44 0.19
45 0.17
46 0.15
47 0.15
48 0.16
49 0.18
50 0.15
51 0.12
52 0.12
53 0.11
54 0.11
55 0.1
56 0.09
57 0.07
58 0.07
59 0.07
60 0.07
61 0.08
62 0.09
63 0.13
64 0.15
65 0.17
66 0.17
67 0.17
68 0.17
69 0.18
70 0.17
71 0.13
72 0.15
73 0.13
74 0.17
75 0.19
76 0.2
77 0.2
78 0.2
79 0.2
80 0.17
81 0.16
82 0.14
83 0.13
84 0.16
85 0.19
86 0.24
87 0.27
88 0.34
89 0.37
90 0.36
91 0.38
92 0.4
93 0.43
94 0.45
95 0.43
96 0.37
97 0.41
98 0.4
99 0.42
100 0.38
101 0.36
102 0.33
103 0.36
104 0.36
105 0.29
106 0.29
107 0.24
108 0.22
109 0.19
110 0.17
111 0.18
112 0.17
113 0.18
114 0.19
115 0.17
116 0.19
117 0.19
118 0.17
119 0.12
120 0.11
121 0.11
122 0.12
123 0.12
124 0.1
125 0.1
126 0.1
127 0.13
128 0.14
129 0.13
130 0.11
131 0.12
132 0.13
133 0.13
134 0.14
135 0.13
136 0.13
137 0.13
138 0.13
139 0.12
140 0.12
141 0.12
142 0.14
143 0.14
144 0.13
145 0.13
146 0.13
147 0.13
148 0.12
149 0.19
150 0.17
151 0.19
152 0.23
153 0.27
154 0.36
155 0.42
156 0.48
157 0.48
158 0.55
159 0.56
160 0.57
161 0.6
162 0.54
163 0.52
164 0.46
165 0.43
166 0.38
167 0.32
168 0.33
169 0.28
170 0.26
171 0.22
172 0.21
173 0.18
174 0.17
175 0.2
176 0.15
177 0.14
178 0.17
179 0.17
180 0.19
181 0.2
182 0.2
183 0.2
184 0.25
185 0.29
186 0.34
187 0.41
188 0.4
189 0.44
190 0.47
191 0.45
192 0.49
193 0.56
194 0.57
195 0.61
196 0.69
197 0.72
198 0.79
199 0.86
200 0.86
201 0.86
202 0.84
203 0.78
204 0.7
205 0.61
206 0.51
207 0.41
208 0.3
209 0.2
210 0.12
211 0.07
212 0.05
213 0.04
214 0.03
215 0.03
216 0.03
217 0.02
218 0.03
219 0.03
220 0.03
221 0.04
222 0.06
223 0.07
224 0.13
225 0.16
226 0.17
227 0.26
228 0.29
229 0.35
230 0.36
231 0.4
232 0.45
233 0.54
234 0.6
235 0.56