Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y1X3C9

Protein Details
Accession A0A1Y1X3C9   
Localization Confidence High
Confidence Score 15.8
NoLS Segment(s)
PositionSequenceProtein Nature
126-150VEYLNKESERKRKRKEEIDKKIEEGBasic
NLS Segment(s)
PositionSequence
134-158ERKRKRKEEIDKKIEEGLKIQTKKR
185-192RFKRNKKR
Subcellular Location(s) nucl 20.5, cyto_nucl 12, mito 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR024974  Sde2_N  
IPR000626  Ubiquitin-like_dom  
IPR029071  Ubiquitin-like_domsf  
Gene Ontology GO:0005737  C:cytoplasm  
GO:0005634  C:nucleus  
GO:0007049  P:cell cycle  
GO:0006397  P:mRNA processing  
GO:0008380  P:RNA splicing  
Pfam View protein in Pfam  
PF13019  Sde2_N_Ubi  
PROSITE View protein in PROSITE  
PS50053  UBIQUITIN_2  
CDD cd17039  Ubl_ubiquitin_like  
Amino Acid Sequences MSFILNLIGNLKPLCINVKNSPIQTIGDLKQYVEETYGISKEEQKISTYSGKYFKNEDKLITSIGLHHDFQITNLSISVLGGKGGFGSMLRAQGGKMSSKKTTNVESCRDLQGRRLKTINDATKLVEYLNKESERKRKRKEEIDKKIEEGLKIQTKKRHRFDDIEYFENHDKILENIKGAVSQGRFKRNKKR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.19
2 0.21
3 0.26
4 0.3
5 0.38
6 0.42
7 0.42
8 0.44
9 0.39
10 0.36
11 0.33
12 0.33
13 0.26
14 0.27
15 0.26
16 0.24
17 0.25
18 0.25
19 0.22
20 0.18
21 0.17
22 0.12
23 0.14
24 0.15
25 0.13
26 0.13
27 0.17
28 0.2
29 0.24
30 0.23
31 0.23
32 0.23
33 0.26
34 0.32
35 0.3
36 0.3
37 0.32
38 0.33
39 0.34
40 0.38
41 0.4
42 0.41
43 0.41
44 0.38
45 0.36
46 0.34
47 0.33
48 0.28
49 0.23
50 0.16
51 0.18
52 0.19
53 0.15
54 0.15
55 0.15
56 0.14
57 0.15
58 0.17
59 0.13
60 0.11
61 0.11
62 0.11
63 0.09
64 0.09
65 0.09
66 0.05
67 0.04
68 0.04
69 0.04
70 0.04
71 0.04
72 0.04
73 0.03
74 0.05
75 0.06
76 0.06
77 0.07
78 0.07
79 0.07
80 0.09
81 0.1
82 0.12
83 0.13
84 0.15
85 0.18
86 0.2
87 0.23
88 0.24
89 0.29
90 0.32
91 0.35
92 0.36
93 0.36
94 0.37
95 0.39
96 0.38
97 0.33
98 0.33
99 0.37
100 0.35
101 0.36
102 0.36
103 0.31
104 0.35
105 0.43
106 0.42
107 0.36
108 0.34
109 0.32
110 0.31
111 0.31
112 0.25
113 0.2
114 0.16
115 0.16
116 0.21
117 0.23
118 0.24
119 0.3
120 0.4
121 0.48
122 0.56
123 0.62
124 0.66
125 0.73
126 0.81
127 0.87
128 0.88
129 0.88
130 0.88
131 0.81
132 0.73
133 0.7
134 0.62
135 0.51
136 0.42
137 0.39
138 0.38
139 0.4
140 0.43
141 0.45
142 0.53
143 0.62
144 0.69
145 0.7
146 0.67
147 0.69
148 0.71
149 0.74
150 0.7
151 0.63
152 0.55
153 0.52
154 0.48
155 0.43
156 0.34
157 0.24
158 0.19
159 0.17
160 0.24
161 0.2
162 0.18
163 0.19
164 0.2
165 0.2
166 0.2
167 0.24
168 0.19
169 0.25
170 0.31
171 0.4
172 0.48