Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y1VW83

Protein Details
Accession A0A1Y1VW83    Localization Confidence Low Confidence Score 9.8
NoLS Segment(s)
PositionSequenceProtein Nature
156-178SDNEYSPNSKNKRKTDQESDGIYHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 16.5, cyto_nucl 10, mito 8
Family & Domain DBs
InterPro View protein in InterPro  
IPR012547  PDDEXK_9  
Pfam View protein in Pfam  
PF08011  PDDEXK_9  
Amino Acid Sequences MTLNNNPKKICKILEKSHMAIIRPGDKIDYGNLKHVIEFAYFNARIHYIVNEEVSEGKGISDFIFYPKNKRQKVIIIELKVNGSAKEAIKQIHQKKYYNDLKNRGYTGNILLVGINLNKKQKSYSCKIEEYDNELKILISDNEYLPNSKNKKELISDNEYSPNSKNKRKTDQESDGIY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.66
2 0.68
3 0.64
4 0.65
5 0.61
6 0.52
7 0.46
8 0.42
9 0.38
10 0.33
11 0.31
12 0.26
13 0.23
14 0.23
15 0.25
16 0.28
17 0.24
18 0.29
19 0.31
20 0.3
21 0.29
22 0.29
23 0.25
24 0.18
25 0.18
26 0.13
27 0.18
28 0.18
29 0.18
30 0.19
31 0.18
32 0.17
33 0.17
34 0.16
35 0.11
36 0.12
37 0.13
38 0.11
39 0.11
40 0.11
41 0.11
42 0.1
43 0.08
44 0.07
45 0.06
46 0.06
47 0.06
48 0.07
49 0.06
50 0.08
51 0.15
52 0.16
53 0.23
54 0.3
55 0.39
56 0.4
57 0.42
58 0.43
59 0.44
60 0.49
61 0.52
62 0.51
63 0.44
64 0.43
65 0.42
66 0.38
67 0.31
68 0.26
69 0.16
70 0.11
71 0.12
72 0.1
73 0.12
74 0.14
75 0.13
76 0.17
77 0.25
78 0.31
79 0.36
80 0.4
81 0.41
82 0.42
83 0.51
84 0.57
85 0.57
86 0.57
87 0.56
88 0.57
89 0.57
90 0.56
91 0.47
92 0.38
93 0.31
94 0.26
95 0.2
96 0.16
97 0.13
98 0.11
99 0.1
100 0.1
101 0.1
102 0.1
103 0.11
104 0.15
105 0.15
106 0.16
107 0.2
108 0.25
109 0.32
110 0.37
111 0.45
112 0.47
113 0.5
114 0.5
115 0.53
116 0.49
117 0.49
118 0.48
119 0.39
120 0.33
121 0.29
122 0.28
123 0.22
124 0.22
125 0.15
126 0.11
127 0.12
128 0.12
129 0.16
130 0.17
131 0.18
132 0.18
133 0.26
134 0.29
135 0.3
136 0.35
137 0.34
138 0.38
139 0.42
140 0.48
141 0.47
142 0.51
143 0.5
144 0.48
145 0.52
146 0.48
147 0.45
148 0.4
149 0.42
150 0.42
151 0.48
152 0.54
153 0.57
154 0.67
155 0.74
156 0.8
157 0.81
158 0.82