Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y1XPX3

Protein Details
Accession A0A1Y1XPX3    Localization Confidence Medium Confidence Score 12.9
NoLS Segment(s)
PositionSequenceProtein Nature
6-50NKEKTAPQTKAERNKPKSKSAKKEEQKLYKQKKAEKNNNKNKYYLHydrophilic
NLS Segment(s)
PositionSequence
4-42KSNKEKTAPQTKAERNKPKSKSAKKEEQKLYKQKKAEKN
Subcellular Location(s) nucl 17, cyto_nucl 11, mito 7
Family & Domain DBs
Amino Acid Sequences MAKKSNKEKTAPQTKAERNKPKSKSAKKEEQKLYKQKKAEKNNNKNKYYLKINLLIPLLTNVFGRLHDIHNKFNFDITELQKKKTEVIRGLNMNTSAFCFFLF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.71
2 0.76
3 0.77
4 0.78
5 0.75
6 0.81
7 0.8
8 0.8
9 0.82
10 0.82
11 0.82
12 0.81
13 0.83
14 0.82
15 0.87
16 0.86
17 0.85
18 0.85
19 0.85
20 0.85
21 0.81
22 0.79
23 0.78
24 0.77
25 0.78
26 0.79
27 0.8
28 0.82
29 0.86
30 0.89
31 0.81
32 0.76
33 0.68
34 0.62
35 0.56
36 0.5
37 0.42
38 0.37
39 0.36
40 0.35
41 0.32
42 0.27
43 0.2
44 0.17
45 0.14
46 0.1
47 0.09
48 0.07
49 0.07
50 0.07
51 0.1
52 0.1
53 0.13
54 0.21
55 0.24
56 0.29
57 0.32
58 0.35
59 0.32
60 0.33
61 0.3
62 0.24
63 0.28
64 0.26
65 0.34
66 0.32
67 0.35
68 0.37
69 0.37
70 0.41
71 0.41
72 0.44
73 0.4
74 0.46
75 0.52
76 0.53
77 0.54
78 0.52
79 0.47
80 0.4
81 0.33
82 0.28
83 0.21