Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y1X0K2

Protein Details
Accession A0A1Y1X0K2   
Localization Confidence Medium
Confidence Score 13.2
NoLS Segment(s)
PositionSequenceProtein Nature
26-57EIRKNDIKEHERKNKQKKQKKLIMKKNEKVILBasic
NLS Segment(s)
PositionSequence
32-51IKEHERKNKQKKQKKLIMKK
Subcellular Location(s) nucl 17.5, cyto_nucl 10, mito 6
Family & Domain DBs
Amino Acid Sequences MDVLLNRVGLNLNSLKYSYNHARWEEIRKNDIKEHERKNKQKKQKKLIMKKNEKVILDTKNINKELYKERIDDTNRTHIIKVDKIEID
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.16
2 0.17
3 0.17
4 0.24
5 0.27
6 0.3
7 0.35
8 0.36
9 0.4
10 0.42
11 0.5
12 0.51
13 0.48
14 0.48
15 0.46
16 0.48
17 0.47
18 0.52
19 0.49
20 0.5
21 0.55
22 0.6
23 0.66
24 0.73
25 0.8
26 0.81
27 0.85
28 0.86
29 0.86
30 0.86
31 0.85
32 0.86
33 0.86
34 0.86
35 0.87
36 0.88
37 0.83
38 0.81
39 0.77
40 0.66
41 0.59
42 0.53
43 0.46
44 0.4
45 0.4
46 0.36
47 0.38
48 0.38
49 0.36
50 0.32
51 0.32
52 0.36
53 0.37
54 0.36
55 0.32
56 0.32
57 0.4
58 0.43
59 0.44
60 0.42
61 0.45
62 0.46
63 0.46
64 0.45
65 0.41
66 0.43
67 0.42
68 0.4