FuNGI

A0A1Y1XIA8

Protein Details

Accession

A0A1Y1XIA8

Localization Confidence

Medium

Confidence Score

10.6

NoLS Segment(s)

Position	Sequence	Protein Nature
473-498	ENDYLFPKYPKQRKVKKSNNNSDVIL	Hydrophilic

NLS Segment(s)

Subcellular Location(s)

nucl 14, plas 7, cyto 4

Family & Domain DBs

InterPro	View protein in InterPro IPR005821 Ion_trans_dom IPR027359 Volt_channel_dom_sf
Gene Ontology	GO:0016020 C:membrane GO:0005216 F:monoatomic ion channel activity
Pfam	View protein in Pfam PF00520 Ion_trans

Amino Acid Sequences

MSDEEKTETSSLLNIDDNENEYVNDNENENENENENENENENENENENENENENENENENENDNGNEIENENENENEYINENENENENEYENENENEYENENENENENENENENENENENENENENENENENENENENENENENENENENENENENENENENENENENEYENENENENENENEYENENENENENENENENENEIENEIENENEYINENENEYENENTETTPLIKKEDEINEIASTSNYHAVNQEDDENLLSIYNETDILFFVKENKKNSTMKSQIGYILNTTAWNTAILVMIACDVLIVVLELVIQLDEKKQCSPVENPQSTENDLFVSTVENLGYVSDVLLYVFTAEVILRIYSFGYKYIFESLINFIDTLTVFVTFITTMLITYYYTNDKAQGFVDILIILRFWRIFCLVESVVNATQMEANLRFKEVLVDLNAEIRILENRKNCYAEKLNELGYDLSKLENDYLFPKYPKQRKVKKSNNNSDVILNVDNY

FASTA Sequence
with NoLS information

AlphaFold Structure
with highlighted NoLS

NoLS Predictions per Residue

Residue Number	Score
1	0.16
2	0.17
3	0.19
4	0.21
5	0.2
6	0.2
7	0.18
8	0.18
9	0.18
10	0.2
11	0.19
12	0.18
13	0.17
14	0.2
15	0.22
16	0.23
17	0.23
18	0.22
19	0.22
20	0.23
21	0.24
22	0.23
23	0.22
24	0.21
25	0.21
26	0.21
27	0.21
28	0.21
29	0.21
30	0.21
31	0.21
32	0.21
33	0.21
34	0.21
35	0.21
36	0.21
37	0.21
38	0.21
39	0.21
40	0.21
41	0.21
42	0.21
43	0.21
44	0.21
45	0.21
46	0.2
47	0.2
48	0.19
49	0.17
50	0.16
51	0.14
52	0.13
53	0.12
54	0.11
55	0.12
56	0.14
57	0.15
58	0.15
59	0.15
60	0.16
61	0.15
62	0.15
63	0.14
64	0.13
65	0.14
66	0.15
67	0.16
68	0.15
69	0.16
70	0.18
71	0.19
72	0.2
73	0.19
74	0.17
75	0.17
76	0.18
77	0.19
78	0.19
79	0.18
80	0.17
81	0.16
82	0.16
83	0.16
84	0.16
85	0.16
86	0.16
87	0.17
88	0.17
89	0.17
90	0.18
91	0.18
92	0.18
93	0.18
94	0.17
95	0.18
96	0.19
97	0.2
98	0.21
99	0.21
100	0.21
101	0.21
102	0.21
103	0.21
104	0.21
105	0.21
106	0.21
107	0.21
108	0.21
109	0.21
110	0.21
111	0.21
112	0.21
113	0.21
114	0.21
115	0.21
116	0.21
117	0.21
118	0.21
119	0.21
120	0.21
121	0.21
122	0.21
123	0.21
124	0.21
125	0.21
126	0.21
127	0.21
128	0.21
129	0.21
130	0.21
131	0.21
132	0.21
133	0.21
134	0.21
135	0.21
136	0.21
137	0.21
138	0.21
139	0.21
140	0.21
141	0.21
142	0.21
143	0.21
144	0.21
145	0.21
146	0.21
147	0.21
148	0.21
149	0.21
150	0.21
151	0.2
152	0.19
153	0.18
154	0.17
155	0.16
156	0.15
157	0.16
158	0.16
159	0.17
160	0.17
161	0.17
162	0.18
163	0.18
164	0.18
165	0.16
166	0.15
167	0.15
168	0.14
169	0.15
170	0.15
171	0.16
172	0.16
173	0.17
174	0.17
175	0.17
176	0.18
177	0.18
178	0.18
179	0.18
180	0.17
181	0.18
182	0.19
183	0.2
184	0.21
185	0.19
186	0.18
187	0.16
188	0.14
189	0.12
190	0.1
191	0.08
192	0.06
193	0.07
194	0.06
195	0.06
196	0.06
197	0.06
198	0.06
199	0.06
200	0.07
201	0.06
202	0.09
203	0.1
204	0.1
205	0.1
206	0.11
207	0.12
208	0.12
209	0.12
210	0.09
211	0.1
212	0.1
213	0.09
214	0.09
215	0.08
216	0.09
217	0.11
218	0.1
219	0.12
220	0.12
221	0.13
222	0.18
223	0.2
224	0.21
225	0.19
226	0.2
227	0.18
228	0.18
229	0.17
230	0.12
231	0.1
232	0.08
233	0.11
234	0.1
235	0.1
236	0.11
237	0.12
238	0.12
239	0.13
240	0.13
241	0.09
242	0.09
243	0.09
244	0.08
245	0.07
246	0.06
247	0.05
248	0.04
249	0.04
250	0.04
251	0.04
252	0.04
253	0.04
254	0.05
255	0.06
256	0.06
257	0.05
258	0.12
259	0.19
260	0.23
261	0.26
262	0.29
263	0.34
264	0.37
265	0.4
266	0.43
267	0.41
268	0.4
269	0.38
270	0.36
271	0.35
272	0.33
273	0.31
274	0.21
275	0.17
276	0.15
277	0.14
278	0.13
279	0.09
280	0.08
281	0.07
282	0.07
283	0.06
284	0.06
285	0.06
286	0.05
287	0.04
288	0.04
289	0.04
290	0.04
291	0.03
292	0.02
293	0.02
294	0.02
295	0.02
296	0.02
297	0.02
298	0.02
299	0.02
300	0.02
301	0.02
302	0.03
303	0.03
304	0.07
305	0.09
306	0.1
307	0.11
308	0.14
309	0.15
310	0.19
311	0.23
312	0.3
313	0.39
314	0.4
315	0.41
316	0.41
317	0.42
318	0.41
319	0.38
320	0.28
321	0.18
322	0.16
323	0.14
324	0.11
325	0.1
326	0.08
327	0.08
328	0.07
329	0.06
330	0.06
331	0.06
332	0.06
333	0.04
334	0.04
335	0.04
336	0.04
337	0.04
338	0.04
339	0.04
340	0.04
341	0.03
342	0.03
343	0.03
344	0.03
345	0.04
346	0.05
347	0.05
348	0.05
349	0.05
350	0.06
351	0.07
352	0.08
353	0.09
354	0.1
355	0.11
356	0.12
357	0.15
358	0.15
359	0.14
360	0.16
361	0.17
362	0.17
363	0.17
364	0.15
365	0.11
366	0.12
367	0.12
368	0.1
369	0.08
370	0.07
371	0.06
372	0.06
373	0.07
374	0.06
375	0.06
376	0.06
377	0.05
378	0.05
379	0.05
380	0.06
381	0.06
382	0.07
383	0.1
384	0.12
385	0.14
386	0.15
387	0.18
388	0.18
389	0.18
390	0.18
391	0.17
392	0.15
393	0.14
394	0.14
395	0.1
396	0.1
397	0.09
398	0.09
399	0.07
400	0.07
401	0.08
402	0.07
403	0.09
404	0.1
405	0.11
406	0.12
407	0.18
408	0.18
409	0.19
410	0.19
411	0.21
412	0.2
413	0.2
414	0.19
415	0.14
416	0.14
417	0.13
418	0.16
419	0.15
420	0.19
421	0.18
422	0.2
423	0.2
424	0.18
425	0.21
426	0.19
427	0.19
428	0.17
429	0.19
430	0.17
431	0.2
432	0.2
433	0.17
434	0.15
435	0.13
436	0.17
437	0.18
438	0.24
439	0.27
440	0.32
441	0.37
442	0.42
443	0.42
444	0.45
445	0.5
446	0.48
447	0.49
448	0.47
449	0.45
450	0.41
451	0.42
452	0.35
453	0.27
454	0.25
455	0.18
456	0.16
457	0.14
458	0.15
459	0.16
460	0.15
461	0.15
462	0.17
463	0.21
464	0.25
465	0.27
466	0.34
467	0.43
468	0.51
469	0.59
470	0.67
471	0.73
472	0.79
473	0.88
474	0.9
475	0.91
476	0.93
477	0.94
478	0.92
479	0.86
480	0.77
481	0.67
482	0.58
483	0.51

A0A1Y1XIA8

3D AlphaFold-predicted Structure Viewer