Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y1X5B7

Protein Details
Accession A0A1Y1X5B7    Localization Confidence Medium Confidence Score 12.3
NoLS Segment(s)
PositionSequenceProtein Nature
131-154EETTKKEETKKEAKKENNKKFYSNHydrophilic
NLS Segment(s)
PositionSequence
135-145KKEETKKEAKK
Subcellular Location(s) nucl 18, cyto_nucl 14.5, cyto 9
Family & Domain DBs
InterPro View protein in InterPro  
IPR002068  A-crystallin/Hsp20_dom  
IPR008978  HSP20-like_chaperone  
PROSITE View protein in PROSITE  
PS01031  SHSP  
Amino Acid Sequences MNINNHLVSRNSLFDDLENEFFNYPLISFPSVYPYYYSHPMESLEKQISKAFNSDVFKSVDFSPKINLSEDEKNYYIHADLPGMNKDQVKMELSDDDRILTISGERETIIDNSNKDANANKEASKEETKKEETTKKEETKKEAKKENNKKFYSNSINVKLNY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.21
2 0.24
3 0.23
4 0.22
5 0.21
6 0.19
7 0.18
8 0.17
9 0.17
10 0.13
11 0.1
12 0.09
13 0.11
14 0.11
15 0.12
16 0.12
17 0.19
18 0.19
19 0.19
20 0.2
21 0.2
22 0.23
23 0.28
24 0.3
25 0.24
26 0.24
27 0.25
28 0.27
29 0.26
30 0.27
31 0.25
32 0.25
33 0.25
34 0.28
35 0.27
36 0.24
37 0.24
38 0.2
39 0.21
40 0.23
41 0.24
42 0.23
43 0.23
44 0.22
45 0.23
46 0.23
47 0.24
48 0.22
49 0.21
50 0.21
51 0.22
52 0.23
53 0.21
54 0.21
55 0.19
56 0.25
57 0.26
58 0.27
59 0.25
60 0.24
61 0.23
62 0.22
63 0.18
64 0.12
65 0.11
66 0.08
67 0.09
68 0.11
69 0.12
70 0.13
71 0.14
72 0.13
73 0.13
74 0.13
75 0.13
76 0.12
77 0.12
78 0.12
79 0.14
80 0.15
81 0.16
82 0.15
83 0.14
84 0.13
85 0.12
86 0.11
87 0.08
88 0.07
89 0.07
90 0.07
91 0.07
92 0.07
93 0.07
94 0.09
95 0.1
96 0.12
97 0.13
98 0.13
99 0.15
100 0.17
101 0.17
102 0.16
103 0.19
104 0.2
105 0.23
106 0.24
107 0.23
108 0.24
109 0.26
110 0.31
111 0.36
112 0.35
113 0.34
114 0.39
115 0.42
116 0.44
117 0.5
118 0.53
119 0.51
120 0.55
121 0.6
122 0.62
123 0.67
124 0.69
125 0.69
126 0.72
127 0.76
128 0.78
129 0.78
130 0.79
131 0.81
132 0.86
133 0.89
134 0.89
135 0.83
136 0.79
137 0.74
138 0.73
139 0.72
140 0.69
141 0.67
142 0.65