Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1Y1X8X5

Protein Details
Accession A0A1Y1X8X5    Localization Confidence Medium Confidence Score 12.7
NoLS Segment(s)
PositionSequenceProtein Nature
1-29MRKQILKNPLKKWKLKKNNEKRKYNMIECHydrophilic
NLS Segment(s)
PositionSequence
8-22NPLKKWKLKKNNEKR
Subcellular Location(s) nucl 18.5, mito_nucl 13.5, mito 7.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR002068  A-crystallin/Hsp20_dom  
IPR008978  HSP20-like_chaperone  
IPR031107  Small_HSP  
Pfam View protein in Pfam  
PF00011  HSP20  
PROSITE View protein in PROSITE  
PS01031  SHSP  
CDD cd06464  ACD_sHsps-like  
Amino Acid Sequences MRKQILKNPLKKWKLKKNNEKRKYNMIECSYGKFSRSFTLPEDANLDDIQAKMENGVLEVIINKIETSKL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.85
2 0.87
3 0.89
4 0.89
5 0.92
6 0.93
7 0.92
8 0.87
9 0.86
10 0.83
11 0.77
12 0.74
13 0.65
14 0.61
15 0.53
16 0.51
17 0.45
18 0.37
19 0.33
20 0.25
21 0.23
22 0.19
23 0.19
24 0.17
25 0.15
26 0.19
27 0.17
28 0.17
29 0.19
30 0.17
31 0.17
32 0.15
33 0.13
34 0.1
35 0.1
36 0.1
37 0.08
38 0.08
39 0.07
40 0.08
41 0.08
42 0.08
43 0.08
44 0.07
45 0.06
46 0.07
47 0.07
48 0.07
49 0.07
50 0.06