Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y1XBS6

Protein Details
Accession A0A1Y1XBS6   
Localization Confidence Low
Confidence Score 9.7
NoLS Segment(s)
PositionSequenceProtein Nature
62-86NDNNENKHKVHNKKLQKKNQELEYEHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 18.5, cyto_nucl 13.5, cyto 7.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR028118  Chibby_fam  
Pfam View protein in Pfam  
PF14645  Chibby  
Amino Acid Sequences MPLFKFIGSHPKEPSFSYFDNTSQPIHIKLGNISAVYSNKKWKIDDENSDEKEYDNNNNIDNDNNENKHKVHNKKLQKKNQELEYENQQLKWKIEILLSKLAEAKYEIEQLRNVEY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.45
2 0.4
3 0.37
4 0.36
5 0.33
6 0.3
7 0.33
8 0.32
9 0.28
10 0.24
11 0.24
12 0.22
13 0.21
14 0.21
15 0.18
16 0.17
17 0.19
18 0.18
19 0.16
20 0.15
21 0.15
22 0.17
23 0.19
24 0.2
25 0.24
26 0.27
27 0.29
28 0.3
29 0.31
30 0.37
31 0.4
32 0.45
33 0.46
34 0.5
35 0.51
36 0.51
37 0.47
38 0.38
39 0.34
40 0.28
41 0.23
42 0.19
43 0.17
44 0.17
45 0.18
46 0.18
47 0.17
48 0.16
49 0.18
50 0.18
51 0.19
52 0.19
53 0.21
54 0.21
55 0.28
56 0.35
57 0.38
58 0.44
59 0.52
60 0.62
61 0.7
62 0.8
63 0.83
64 0.84
65 0.86
66 0.83
67 0.81
68 0.78
69 0.7
70 0.64
71 0.62
72 0.6
73 0.51
74 0.46
75 0.42
76 0.38
77 0.36
78 0.33
79 0.27
80 0.21
81 0.24
82 0.27
83 0.26
84 0.32
85 0.3
86 0.29
87 0.31
88 0.29
89 0.27
90 0.24
91 0.22
92 0.17
93 0.24
94 0.24
95 0.23
96 0.26