Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1Y1WZ12

Protein Details
Accession A0A1Y1WZ12    Localization Confidence Low Confidence Score 6.1
NoLS Segment(s)
PositionSequenceProtein Nature
301-327LTKENVNKCKKVKSEKCQKFYNDKINNHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto 15, cyto_nucl 10.5, nucl 4, mito 3, pero 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR000209  Peptidase_S8/S53_dom  
IPR036852  Peptidase_S8/S53_dom_sf  
IPR023828  Peptidase_S8_Ser-AS  
Gene Ontology GO:0004252  F:serine-type endopeptidase activity  
GO:0006508  P:proteolysis  
Pfam View protein in Pfam  
PF00082  Peptidase_S8  
PROSITE View protein in PROSITE  
PS51892  SUBTILASE  
PS00138  SUBTILASE_SER  
Amino Acid Sequences MTSSMAGGSIYGVAKKANIHMIVSDFVVINTLRSLDFIMNNATPGKSIISMSLGGSGYKKMEDDKLEELIKKGFIIFAAAGNNNKNCCSREHDDSFTNFSGYRKAIVVGAAYADVINGGYIKADFSNYGDCVDIFASCKGLYPNIQDNTTSEIGGTSAATPLVAGVAALIMAEHPEKEFNNDLMRQTLIDMSMKGYINFNNENASIDTPNRFLNNGKVITYVQNKPKAECGESIGSCPNGCCSKDGMCISYEKTPKQECLVENGCQSEFGYCITFDEAEKACNTEIDEYKECLIEIIQTDLTKENVNKCKKVKSEKCQKFYNDKINNGSMCTL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.12
2 0.14
3 0.17
4 0.21
5 0.21
6 0.21
7 0.23
8 0.25
9 0.24
10 0.23
11 0.2
12 0.14
13 0.12
14 0.14
15 0.12
16 0.1
17 0.09
18 0.1
19 0.09
20 0.09
21 0.11
22 0.11
23 0.12
24 0.13
25 0.17
26 0.17
27 0.18
28 0.19
29 0.17
30 0.15
31 0.15
32 0.15
33 0.12
34 0.12
35 0.12
36 0.12
37 0.13
38 0.13
39 0.16
40 0.15
41 0.14
42 0.14
43 0.15
44 0.13
45 0.13
46 0.14
47 0.12
48 0.17
49 0.19
50 0.23
51 0.25
52 0.28
53 0.3
54 0.31
55 0.3
56 0.27
57 0.24
58 0.2
59 0.17
60 0.13
61 0.1
62 0.11
63 0.1
64 0.1
65 0.13
66 0.14
67 0.16
68 0.19
69 0.21
70 0.2
71 0.22
72 0.23
73 0.21
74 0.22
75 0.28
76 0.3
77 0.36
78 0.41
79 0.43
80 0.44
81 0.45
82 0.47
83 0.4
84 0.35
85 0.28
86 0.23
87 0.23
88 0.19
89 0.18
90 0.14
91 0.14
92 0.13
93 0.13
94 0.13
95 0.09
96 0.09
97 0.07
98 0.07
99 0.06
100 0.05
101 0.04
102 0.03
103 0.03
104 0.03
105 0.03
106 0.03
107 0.03
108 0.04
109 0.04
110 0.05
111 0.05
112 0.06
113 0.09
114 0.09
115 0.1
116 0.1
117 0.09
118 0.1
119 0.09
120 0.09
121 0.07
122 0.07
123 0.08
124 0.07
125 0.09
126 0.08
127 0.09
128 0.1
129 0.13
130 0.21
131 0.21
132 0.22
133 0.21
134 0.22
135 0.26
136 0.25
137 0.2
138 0.13
139 0.11
140 0.1
141 0.1
142 0.09
143 0.04
144 0.04
145 0.04
146 0.04
147 0.04
148 0.03
149 0.03
150 0.03
151 0.02
152 0.02
153 0.02
154 0.02
155 0.02
156 0.02
157 0.02
158 0.02
159 0.03
160 0.03
161 0.03
162 0.05
163 0.05
164 0.08
165 0.1
166 0.11
167 0.14
168 0.16
169 0.16
170 0.16
171 0.16
172 0.13
173 0.12
174 0.11
175 0.09
176 0.08
177 0.08
178 0.07
179 0.11
180 0.11
181 0.11
182 0.12
183 0.12
184 0.16
185 0.16
186 0.16
187 0.14
188 0.14
189 0.15
190 0.15
191 0.16
192 0.13
193 0.13
194 0.14
195 0.14
196 0.15
197 0.14
198 0.13
199 0.13
200 0.17
201 0.22
202 0.22
203 0.21
204 0.21
205 0.22
206 0.26
207 0.31
208 0.32
209 0.33
210 0.39
211 0.4
212 0.39
213 0.44
214 0.42
215 0.39
216 0.34
217 0.31
218 0.3
219 0.3
220 0.3
221 0.26
222 0.24
223 0.21
224 0.2
225 0.19
226 0.17
227 0.17
228 0.17
229 0.17
230 0.2
231 0.26
232 0.28
233 0.25
234 0.22
235 0.24
236 0.25
237 0.3
238 0.31
239 0.26
240 0.32
241 0.33
242 0.34
243 0.37
244 0.4
245 0.33
246 0.37
247 0.4
248 0.36
249 0.35
250 0.35
251 0.31
252 0.26
253 0.25
254 0.17
255 0.13
256 0.12
257 0.11
258 0.09
259 0.1
260 0.11
261 0.12
262 0.11
263 0.16
264 0.15
265 0.16
266 0.16
267 0.17
268 0.15
269 0.16
270 0.17
271 0.18
272 0.21
273 0.26
274 0.29
275 0.29
276 0.3
277 0.29
278 0.27
279 0.22
280 0.18
281 0.14
282 0.12
283 0.14
284 0.15
285 0.14
286 0.16
287 0.17
288 0.18
289 0.2
290 0.23
291 0.29
292 0.36
293 0.44
294 0.51
295 0.54
296 0.62
297 0.67
298 0.75
299 0.76
300 0.77
301 0.81
302 0.84
303 0.86
304 0.85
305 0.84
306 0.83
307 0.82
308 0.82
309 0.79
310 0.75
311 0.75
312 0.73
313 0.66