Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

B8P024

Protein Details
Accession B8P024    Localization Confidence Medium Confidence Score 10.7
NoLS Segment(s)
PositionSequenceProtein Nature
29-52VSQCNKCRELRRTKRMHNKCNCVPHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 21.5, cyto_nucl 13.5, mito 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR001083  Cu_fist_DNA-bd_dom  
IPR036395  Cu_fist_DNA-bd_dom_sf  
Gene Ontology GO:0005634  C:nucleus  
GO:0005507  F:copper ion binding  
GO:0003677  F:DNA binding  
GO:0003700  F:DNA-binding transcription factor activity  
KEGG ppl:POSPLDRAFT_47293  -  
Pfam View protein in Pfam  
PF00649  Copper-fist  
PROSITE View protein in PROSITE  
PS50073  COPPER_FIST_2  
Amino Acid Sequences ESCIKGHRSSSCQHTDRPLYEIKKKGRPVSQCNKCRELRRTKRMHNKCNCVPGVCTELSSSESNEVGSSSGTSSPEKRAVTPLLLHGRTSLHVS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.54
2 0.54
3 0.51
4 0.49
5 0.49
6 0.45
7 0.5
8 0.55
9 0.54
10 0.56
11 0.61
12 0.64
13 0.63
14 0.66
15 0.68
16 0.7
17 0.73
18 0.73
19 0.73
20 0.73
21 0.7
22 0.7
23 0.69
24 0.69
25 0.7
26 0.72
27 0.75
28 0.78
29 0.84
30 0.86
31 0.87
32 0.85
33 0.82
34 0.76
35 0.75
36 0.66
37 0.56
38 0.46
39 0.38
40 0.34
41 0.25
42 0.22
43 0.14
44 0.14
45 0.16
46 0.16
47 0.14
48 0.12
49 0.12
50 0.11
51 0.11
52 0.1
53 0.07
54 0.07
55 0.07
56 0.07
57 0.08
58 0.1
59 0.12
60 0.14
61 0.18
62 0.24
63 0.25
64 0.25
65 0.29
66 0.3
67 0.31
68 0.31
69 0.34
70 0.38
71 0.37
72 0.36
73 0.33
74 0.31