Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y1XHN7

Protein Details
Accession A0A1Y1XHN7   
Localization Confidence Medium
Confidence Score 10.8
NoLS Segment(s)
PositionSequenceProtein Nature
4-34AIENKKNIKDLPKYKKPKRNLPVRLPKQSRIHydrophilic
NLS Segment(s)
PositionSequence
11-30IKDLPKYKKPKRNLPVRLPK
Subcellular Location(s) nucl 8.5, plas 8, cyto_nucl 6, E.R. 3, cyto 2.5, mito 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR019013  Vma21  
Gene Ontology GO:0031410  C:cytoplasmic vesicle  
GO:0016020  C:membrane  
GO:0070072  P:vacuolar proton-transporting V-type ATPase complex assembly  
Pfam View protein in Pfam  
PF09446  VMA21  
Amino Acid Sequences MGSAIENKKNIKDLPKYKKPKRNLPVRLPKQSRIPKDVLLKLILFTILMFTLPFIVYYYTLDRFFIGNTTYAALAAAFTANLVIAAYVVVAIVEDRGDDDDNTETNNKTE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.6
2 0.68
3 0.76
4 0.82
5 0.87
6 0.87
7 0.88
8 0.87
9 0.87
10 0.87
11 0.87
12 0.88
13 0.88
14 0.89
15 0.84
16 0.78
17 0.78
18 0.77
19 0.71
20 0.66
21 0.6
22 0.55
23 0.57
24 0.56
25 0.47
26 0.4
27 0.34
28 0.28
29 0.25
30 0.19
31 0.12
32 0.08
33 0.06
34 0.04
35 0.04
36 0.04
37 0.03
38 0.04
39 0.04
40 0.04
41 0.04
42 0.05
43 0.05
44 0.07
45 0.09
46 0.1
47 0.1
48 0.1
49 0.11
50 0.1
51 0.1
52 0.1
53 0.09
54 0.08
55 0.08
56 0.09
57 0.08
58 0.07
59 0.07
60 0.06
61 0.05
62 0.05
63 0.04
64 0.03
65 0.03
66 0.03
67 0.03
68 0.03
69 0.03
70 0.03
71 0.02
72 0.03
73 0.03
74 0.02
75 0.02
76 0.02
77 0.02
78 0.03
79 0.03
80 0.03
81 0.03
82 0.04
83 0.06
84 0.08
85 0.08
86 0.1
87 0.12
88 0.13
89 0.16
90 0.18