Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y1X1P5

Protein Details
Accession A0A1Y1X1P5   
Localization Confidence Medium
Confidence Score 12.4
NoLS Segment(s)
PositionSequenceProtein Nature
18-37TCYWNNCRYTKKKRDHVTSHHydrophilic
50-69QICYRAFKRPQDLKKHQAIHHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 20, cyto_nucl 13, cyto 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR036236  Znf_C2H2_sf  
IPR013087  Znf_C2H2_type  
Pfam View protein in Pfam  
PF00096  zf-C2H2  
PROSITE View protein in PROSITE  
PS00028  ZINC_FINGER_C2H2_1  
PS50157  ZINC_FINGER_C2H2_2  
Amino Acid Sequences HLCDDHVGRKANNNLCLTCYWNNCRYTKKKRDHVTSHIRKHIEFKPHICQICYRAFKRPQDLKKHQAIH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.44
2 0.42
3 0.42
4 0.4
5 0.36
6 0.35
7 0.34
8 0.37
9 0.4
10 0.41
11 0.48
12 0.53
13 0.58
14 0.63
15 0.67
16 0.71
17 0.75
18 0.82
19 0.8
20 0.79
21 0.8
22 0.79
23 0.76
24 0.73
25 0.66
26 0.56
27 0.55
28 0.52
29 0.5
30 0.44
31 0.42
32 0.43
33 0.49
34 0.5
35 0.45
36 0.43
37 0.39
38 0.44
39 0.47
40 0.41
41 0.44
42 0.51
43 0.57
44 0.64
45 0.69
46 0.69
47 0.72
48 0.8
49 0.79