Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y1WXU6

Protein Details
Accession A0A1Y1WXU6    Localization Confidence Medium Confidence Score 11.3
NoLS Segment(s)
PositionSequenceProtein Nature
15-41LERNRQAALKCRQKKKQWLISLQKQIDHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 24, cyto_nucl 14
Family & Domain DBs
InterPro View protein in InterPro  
IPR004827  bZIP  
IPR046347  bZIP_sf  
IPR002112  Leuzip_Jun  
Gene Ontology GO:0003677  F:DNA binding  
GO:0003700  F:DNA-binding transcription factor activity  
Pfam View protein in Pfam  
PF00170  bZIP_1  
PROSITE View protein in PROSITE  
PS50217  BZIP  
CDD cd14687  bZIP_ATF2  
Amino Acid Sequences KRSRYETDEKKRNVLERNRQAALKCRQKKKQWLISLQKQIDTFTAENETLQNQAILLQEEILTLRALLLTHKPCSLNKNNE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.68
2 0.68
3 0.68
4 0.72
5 0.67
6 0.64
7 0.6
8 0.6
9 0.59
10 0.59
11 0.58
12 0.6
13 0.67
14 0.73
15 0.82
16 0.83
17 0.83
18 0.8
19 0.81
20 0.81
21 0.81
22 0.82
23 0.72
24 0.64
25 0.54
26 0.46
27 0.37
28 0.31
29 0.22
30 0.13
31 0.15
32 0.12
33 0.12
34 0.12
35 0.12
36 0.09
37 0.09
38 0.08
39 0.06
40 0.07
41 0.08
42 0.08
43 0.08
44 0.07
45 0.07
46 0.08
47 0.08
48 0.08
49 0.07
50 0.05
51 0.05
52 0.06
53 0.06
54 0.08
55 0.15
56 0.19
57 0.21
58 0.24
59 0.27
60 0.29
61 0.38