Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1Y1WVP9

Protein Details
Accession A0A1Y1WVP9    Localization Confidence Low Confidence Score 8.6
NoLS Segment(s)
PositionSequenceProtein Nature
88-113KWFNDILKRKNKKIKFKYNSTKYNFIHydrophilic
NLS Segment(s)
PositionSequence
99-99K
Subcellular Location(s) mito 13, pero 4, E.R. 3, plas 2, cyto_nucl 2, nucl 1.5, cyto 1.5
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MVKIKELLFFMIITINILCIYGLQKNEIKNTNTYNCNVASIDNSLKLENNKYDFRNNLNHKIDSYYKHKSNCINKAYSIMSHSYGAYKWFNDILKRKNKKIKFKYNSTKYNFINPPTFINTNIIKLNNLNKNNSNMPLNNNVSNRINVIKF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.1
2 0.09
3 0.08
4 0.08
5 0.07
6 0.06
7 0.08
8 0.11
9 0.12
10 0.15
11 0.18
12 0.21
13 0.27
14 0.32
15 0.33
16 0.34
17 0.4
18 0.42
19 0.42
20 0.41
21 0.38
22 0.32
23 0.32
24 0.27
25 0.21
26 0.17
27 0.17
28 0.17
29 0.16
30 0.16
31 0.15
32 0.16
33 0.18
34 0.2
35 0.2
36 0.23
37 0.25
38 0.27
39 0.31
40 0.31
41 0.33
42 0.39
43 0.41
44 0.47
45 0.47
46 0.45
47 0.41
48 0.43
49 0.42
50 0.37
51 0.37
52 0.35
53 0.35
54 0.37
55 0.4
56 0.44
57 0.49
58 0.53
59 0.51
60 0.45
61 0.41
62 0.42
63 0.39
64 0.32
65 0.25
66 0.18
67 0.15
68 0.14
69 0.14
70 0.11
71 0.11
72 0.13
73 0.12
74 0.11
75 0.11
76 0.13
77 0.15
78 0.2
79 0.26
80 0.32
81 0.42
82 0.48
83 0.55
84 0.62
85 0.69
86 0.74
87 0.78
88 0.81
89 0.79
90 0.83
91 0.86
92 0.86
93 0.88
94 0.82
95 0.8
96 0.7
97 0.71
98 0.64
99 0.57
100 0.52
101 0.44
102 0.42
103 0.4
104 0.39
105 0.31
106 0.32
107 0.29
108 0.27
109 0.29
110 0.26
111 0.22
112 0.24
113 0.32
114 0.36
115 0.38
116 0.41
117 0.41
118 0.46
119 0.49
120 0.49
121 0.46
122 0.39
123 0.4
124 0.43
125 0.44
126 0.45
127 0.43
128 0.44
129 0.42
130 0.41
131 0.39