Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y1X9E8

Protein Details
Accession A0A1Y1X9E8   
Localization Confidence Low
Confidence Score 9
NoLS Segment(s)
PositionSequenceProtein Nature
15-37DKLASKKKYRKGKIVIAKPQKLFHydrophilic
NLS Segment(s)
PositionSequence
20-27KKKYRKGK
Subcellular Location(s) cyto 16.5, cyto_nucl 11.5, nucl 3.5, pero 3, mito 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR036286  LexA/Signal_pep-like_sf  
IPR000223  Pept_S26A_signal_pept_1  
IPR019757  Pept_S26A_signal_pept_1_Lys-AS  
IPR019533  Peptidase_S26  
Gene Ontology GO:0016020  C:membrane  
GO:0004252  F:serine-type endopeptidase activity  
GO:0006465  P:signal peptide processing  
Pfam View protein in Pfam  
PF10502  Peptidase_S26  
PROSITE View protein in PROSITE  
PS00760  SPASE_I_2  
CDD cd06530  S26_SPase_I  
Amino Acid Sequences MLPTLSQSGDYIFIDKLASKKKYRKGKIVIAKPQKLFFPNYESKNNYKVCKRIVGEPGDIIIVPFIMDDFLNGNLVPEGHVWLQGDNIYDSVDSRDYGPVPIKDIDGIVRFKVVQY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.12
2 0.14
3 0.18
4 0.24
5 0.29
6 0.36
7 0.45
8 0.53
9 0.63
10 0.69
11 0.74
12 0.74
13 0.78
14 0.8
15 0.81
16 0.83
17 0.82
18 0.81
19 0.73
20 0.67
21 0.59
22 0.52
23 0.45
24 0.37
25 0.34
26 0.34
27 0.37
28 0.41
29 0.42
30 0.42
31 0.47
32 0.49
33 0.45
34 0.43
35 0.43
36 0.4
37 0.43
38 0.41
39 0.4
40 0.41
41 0.4
42 0.36
43 0.31
44 0.29
45 0.22
46 0.2
47 0.14
48 0.08
49 0.04
50 0.03
51 0.03
52 0.02
53 0.03
54 0.03
55 0.03
56 0.04
57 0.05
58 0.05
59 0.05
60 0.06
61 0.05
62 0.06
63 0.06
64 0.05
65 0.07
66 0.07
67 0.09
68 0.09
69 0.09
70 0.1
71 0.1
72 0.11
73 0.09
74 0.09
75 0.08
76 0.08
77 0.08
78 0.1
79 0.1
80 0.09
81 0.1
82 0.13
83 0.13
84 0.16
85 0.21
86 0.19
87 0.22
88 0.23
89 0.22
90 0.21
91 0.21
92 0.22
93 0.21
94 0.22
95 0.19
96 0.2