Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

B8PC61

Protein Details
Accession B8PC61    Localization Confidence High Confidence Score 16.4
NoLS Segment(s)
PositionSequenceProtein Nature
4-27VDSSQEPRRSQREKKQTTHFVSVNHydrophilic
70-105FNAPKPKPKAPAKVKRKARAPPPPKKPRVRAKKAAABasic
NLS Segment(s)
PositionSequence
73-126PKPKPKAPAKVKRKARAPPPPKKPRVRAKKAAAPKVAAKITLPKPKKTTTRKAK
Subcellular Location(s) nucl 24.5, cyto_nucl 13.5
Family & Domain DBs
KEGG ppl:POSPLDRAFT_93983  -  
Amino Acid Sequences MADVDSSQEPRRSQREKKQTTHFVSVNSTLLKRKRSDATTTDEDIGNEPSEPSDEESNDSGLEPEEGEEFNAPKPKPKAPAKVKRKARAPPPPKKPRVRAKKAAAPKVAAKITLPKPKKTTTRKAKQGGADSTAFDAEKVAQDTRISGDNPLFNAIMNPAAALQSTAEDFLESLSQTPGASLAELTNCILHEAVDYDGVVDALDNFTEGLKKDMKREHSVITDTCMQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.64
2 0.71
3 0.76
4 0.82
5 0.85
6 0.86
7 0.84
8 0.83
9 0.74
10 0.66
11 0.61
12 0.55
13 0.47
14 0.4
15 0.34
16 0.33
17 0.36
18 0.39
19 0.37
20 0.4
21 0.44
22 0.46
23 0.51
24 0.49
25 0.52
26 0.51
27 0.52
28 0.48
29 0.41
30 0.37
31 0.31
32 0.29
33 0.21
34 0.15
35 0.12
36 0.1
37 0.11
38 0.11
39 0.12
40 0.13
41 0.13
42 0.16
43 0.16
44 0.17
45 0.16
46 0.15
47 0.12
48 0.1
49 0.1
50 0.07
51 0.06
52 0.07
53 0.07
54 0.07
55 0.08
56 0.08
57 0.11
58 0.17
59 0.16
60 0.22
61 0.26
62 0.3
63 0.38
64 0.45
65 0.53
66 0.58
67 0.69
68 0.72
69 0.78
70 0.84
71 0.83
72 0.82
73 0.79
74 0.78
75 0.78
76 0.78
77 0.79
78 0.8
79 0.83
80 0.85
81 0.86
82 0.85
83 0.85
84 0.86
85 0.85
86 0.83
87 0.8
88 0.79
89 0.79
90 0.77
91 0.69
92 0.6
93 0.53
94 0.48
95 0.41
96 0.33
97 0.24
98 0.24
99 0.29
100 0.35
101 0.36
102 0.35
103 0.38
104 0.44
105 0.53
106 0.54
107 0.59
108 0.61
109 0.68
110 0.74
111 0.76
112 0.75
113 0.7
114 0.68
115 0.6
116 0.52
117 0.43
118 0.34
119 0.28
120 0.24
121 0.19
122 0.12
123 0.1
124 0.07
125 0.07
126 0.09
127 0.09
128 0.09
129 0.09
130 0.1
131 0.11
132 0.13
133 0.12
134 0.12
135 0.14
136 0.14
137 0.15
138 0.16
139 0.14
140 0.12
141 0.12
142 0.11
143 0.09
144 0.08
145 0.07
146 0.05
147 0.05
148 0.05
149 0.05
150 0.05
151 0.05
152 0.05
153 0.06
154 0.06
155 0.05
156 0.05
157 0.06
158 0.07
159 0.06
160 0.07
161 0.07
162 0.07
163 0.07
164 0.07
165 0.07
166 0.06
167 0.07
168 0.06
169 0.07
170 0.07
171 0.08
172 0.09
173 0.09
174 0.09
175 0.09
176 0.09
177 0.08
178 0.08
179 0.08
180 0.09
181 0.08
182 0.08
183 0.08
184 0.08
185 0.08
186 0.07
187 0.05
188 0.05
189 0.05
190 0.05
191 0.05
192 0.05
193 0.06
194 0.08
195 0.09
196 0.12
197 0.19
198 0.21
199 0.28
200 0.36
201 0.43
202 0.49
203 0.52
204 0.54
205 0.53
206 0.56
207 0.5