Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1Y1XK59

Protein Details
Accession A0A1Y1XK59    Localization Confidence Medium Confidence Score 12
NoLS Segment(s)
PositionSequenceProtein Nature
17-53NENKNRTLNKNIKENKNKGKINKSKNKNESKNENENEHydrophilic
NLS Segment(s)
PositionSequence
29-42KENKNKGKINKSKN
Subcellular Location(s) nucl 15.5, cyto_nucl 11.833, cyto 7, cyto_pero 4.333
Family & Domain DBs
Amino Acid Sequences MEISDENNDENGNENENENKNRTLNKNIKENKNKGKINKSKNKNESKNENENENEINNEENKENLKRITRRNMTEIKLLEKDQKFNILNETKNLCPKINLAQLLAASPALRKELEQSLKLRVEKITCSVASTSIPIIIGKSYNTPLKVLFDTGVNINIITRKF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.17
2 0.23
3 0.28
4 0.33
5 0.32
6 0.34
7 0.34
8 0.41
9 0.44
10 0.48
11 0.52
12 0.54
13 0.61
14 0.66
15 0.73
16 0.77
17 0.81
18 0.81
19 0.82
20 0.82
21 0.8
22 0.82
23 0.81
24 0.81
25 0.82
26 0.82
27 0.82
28 0.86
29 0.89
30 0.87
31 0.86
32 0.85
33 0.83
34 0.83
35 0.75
36 0.69
37 0.6
38 0.53
39 0.46
40 0.36
41 0.28
42 0.18
43 0.17
44 0.14
45 0.14
46 0.12
47 0.12
48 0.14
49 0.15
50 0.16
51 0.18
52 0.24
53 0.29
54 0.35
55 0.44
56 0.48
57 0.49
58 0.53
59 0.57
60 0.52
61 0.51
62 0.45
63 0.39
64 0.34
65 0.32
66 0.33
67 0.28
68 0.28
69 0.23
70 0.29
71 0.26
72 0.24
73 0.3
74 0.26
75 0.26
76 0.27
77 0.3
78 0.25
79 0.29
80 0.3
81 0.23
82 0.2
83 0.21
84 0.24
85 0.26
86 0.25
87 0.21
88 0.2
89 0.2
90 0.19
91 0.18
92 0.12
93 0.07
94 0.06
95 0.07
96 0.07
97 0.07
98 0.07
99 0.1
100 0.18
101 0.22
102 0.25
103 0.27
104 0.32
105 0.37
106 0.38
107 0.36
108 0.31
109 0.29
110 0.27
111 0.29
112 0.27
113 0.22
114 0.23
115 0.22
116 0.21
117 0.19
118 0.18
119 0.15
120 0.11
121 0.12
122 0.1
123 0.1
124 0.1
125 0.1
126 0.1
127 0.13
128 0.17
129 0.21
130 0.22
131 0.22
132 0.23
133 0.26
134 0.27
135 0.25
136 0.22
137 0.18
138 0.2
139 0.2
140 0.2
141 0.16
142 0.14
143 0.14