Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y1WS63

Protein Details
Accession A0A1Y1WS63   
Localization Confidence Low
Confidence Score 9.4
NoLS Segment(s)
PositionSequenceProtein Nature
50-76IEIIQFIKKNKKSKKNKKIIKTFHFLLHydrophilic
NLS Segment(s)
PositionSequence
57-68KKNKKSKKNKKI
Subcellular Location(s) mito 10, pero 5, nucl 4.5, cyto_nucl 4.5, cyto 3.5, plas 2, E.R. 2
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MLLIVYTKSINFRQDVIYGHRIVSFFKIQKSYISIFPFEFTSLYNFYIKIEIIQFIKKNKKSKKNKKIIKTFHFLLSLSFNFFLFFFYIIYELYIFILFYFYFY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.25
2 0.28
3 0.31
4 0.32
5 0.3
6 0.29
7 0.29
8 0.26
9 0.25
10 0.26
11 0.26
12 0.23
13 0.26
14 0.28
15 0.27
16 0.29
17 0.32
18 0.3
19 0.28
20 0.28
21 0.26
22 0.23
23 0.24
24 0.22
25 0.19
26 0.16
27 0.11
28 0.12
29 0.12
30 0.13
31 0.12
32 0.12
33 0.11
34 0.12
35 0.11
36 0.09
37 0.08
38 0.08
39 0.09
40 0.12
41 0.14
42 0.19
43 0.28
44 0.33
45 0.42
46 0.49
47 0.59
48 0.68
49 0.77
50 0.82
51 0.85
52 0.88
53 0.89
54 0.9
55 0.9
56 0.85
57 0.81
58 0.73
59 0.65
60 0.58
61 0.48
62 0.39
63 0.33
64 0.27
65 0.22
66 0.2
67 0.16
68 0.15
69 0.15
70 0.15
71 0.11
72 0.11
73 0.08
74 0.08
75 0.09
76 0.09
77 0.1
78 0.08
79 0.08
80 0.08
81 0.08
82 0.07
83 0.07
84 0.08