Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1Y1XR99

Protein Details
Accession A0A1Y1XR99    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
30-49PDEKSFKKYMEAKRKEKTSTHydrophilic
NLS Segment(s)
Subcellular Location(s) extr 16, pero 4, golg 3, cyto_pero 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR000744  NSF_attach  
IPR011990  TPR-like_helical_dom_sf  
IPR019734  TPR_repeat  
Gene Ontology GO:0006886  P:intracellular protein transport  
Pfam View protein in Pfam  
PF14938  SNAP  
PROSITE View protein in PROSITE  
PS50005  TPR  
Amino Acid Sequences MSEKIVEQGGNMIKVLLFAALCAVCYKTNPDEKSFKKYMEAKRKEKTSTTNSKVLNKMNNMISQAVAPLPNFTYNDYKVCSVCTIEDGPMFIGICNSWYPIGGGKSSKEQEQADAEAEKKIEQLVISGNKEKAQNNYNEAGKLYVKAAQGYEKERNTYEAACNYENAFKVYQSDENIGAASENAKKAARLFASQERTYSRAARIYESLAQLYKKQKDLKSAFENYTSAVNLYNKMDNNSGIQTRIAQANLAAEMGGYNTDKAIELFEDIAKRSVDEPLLKYNVVSSVAKASYLALSKCISKDNFSNFSSTLGKYIQAYPAFEDSPEYDLFHDVDLAITTSNPDKVNELCTKFKQTHSLAEWENEILDNAIKYADQKSVSIL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.17
2 0.17
3 0.11
4 0.07
5 0.06
6 0.1
7 0.09
8 0.1
9 0.1
10 0.12
11 0.11
12 0.13
13 0.18
14 0.23
15 0.32
16 0.35
17 0.4
18 0.48
19 0.52
20 0.6
21 0.59
22 0.53
23 0.52
24 0.58
25 0.63
26 0.64
27 0.7
28 0.7
29 0.75
30 0.8
31 0.77
32 0.74
33 0.73
34 0.72
35 0.72
36 0.7
37 0.68
38 0.66
39 0.68
40 0.68
41 0.65
42 0.63
43 0.56
44 0.55
45 0.52
46 0.5
47 0.44
48 0.39
49 0.33
50 0.25
51 0.22
52 0.18
53 0.15
54 0.12
55 0.12
56 0.12
57 0.15
58 0.15
59 0.17
60 0.22
61 0.23
62 0.26
63 0.26
64 0.27
65 0.24
66 0.25
67 0.23
68 0.18
69 0.17
70 0.17
71 0.16
72 0.16
73 0.16
74 0.15
75 0.14
76 0.14
77 0.13
78 0.1
79 0.09
80 0.07
81 0.08
82 0.08
83 0.08
84 0.07
85 0.07
86 0.08
87 0.11
88 0.13
89 0.13
90 0.15
91 0.15
92 0.22
93 0.24
94 0.25
95 0.26
96 0.26
97 0.26
98 0.27
99 0.27
100 0.22
101 0.22
102 0.21
103 0.18
104 0.17
105 0.15
106 0.12
107 0.11
108 0.1
109 0.08
110 0.08
111 0.12
112 0.17
113 0.19
114 0.23
115 0.23
116 0.25
117 0.29
118 0.3
119 0.29
120 0.3
121 0.31
122 0.32
123 0.35
124 0.34
125 0.31
126 0.29
127 0.27
128 0.21
129 0.18
130 0.15
131 0.15
132 0.14
133 0.14
134 0.15
135 0.17
136 0.19
137 0.23
138 0.29
139 0.25
140 0.27
141 0.26
142 0.28
143 0.26
144 0.26
145 0.23
146 0.2
147 0.22
148 0.21
149 0.21
150 0.2
151 0.21
152 0.19
153 0.18
154 0.15
155 0.11
156 0.13
157 0.14
158 0.15
159 0.14
160 0.15
161 0.13
162 0.13
163 0.13
164 0.11
165 0.09
166 0.07
167 0.08
168 0.08
169 0.07
170 0.09
171 0.09
172 0.09
173 0.1
174 0.14
175 0.13
176 0.13
177 0.16
178 0.22
179 0.28
180 0.28
181 0.29
182 0.27
183 0.28
184 0.28
185 0.27
186 0.21
187 0.2
188 0.2
189 0.21
190 0.2
191 0.2
192 0.22
193 0.21
194 0.2
195 0.17
196 0.16
197 0.19
198 0.25
199 0.26
200 0.28
201 0.34
202 0.35
203 0.44
204 0.46
205 0.49
206 0.5
207 0.52
208 0.48
209 0.43
210 0.41
211 0.32
212 0.3
213 0.22
214 0.15
215 0.12
216 0.12
217 0.12
218 0.13
219 0.16
220 0.15
221 0.17
222 0.18
223 0.16
224 0.17
225 0.18
226 0.17
227 0.15
228 0.14
229 0.13
230 0.14
231 0.15
232 0.13
233 0.1
234 0.1
235 0.1
236 0.1
237 0.09
238 0.07
239 0.05
240 0.05
241 0.05
242 0.05
243 0.05
244 0.04
245 0.04
246 0.05
247 0.06
248 0.06
249 0.06
250 0.06
251 0.06
252 0.08
253 0.1
254 0.11
255 0.11
256 0.14
257 0.13
258 0.13
259 0.13
260 0.15
261 0.16
262 0.18
263 0.2
264 0.24
265 0.26
266 0.25
267 0.24
268 0.23
269 0.21
270 0.21
271 0.19
272 0.13
273 0.16
274 0.16
275 0.16
276 0.16
277 0.14
278 0.14
279 0.17
280 0.16
281 0.14
282 0.15
283 0.17
284 0.19
285 0.24
286 0.22
287 0.23
288 0.29
289 0.34
290 0.39
291 0.37
292 0.39
293 0.33
294 0.36
295 0.36
296 0.3
297 0.25
298 0.2
299 0.2
300 0.19
301 0.21
302 0.24
303 0.23
304 0.23
305 0.23
306 0.26
307 0.25
308 0.23
309 0.23
310 0.18
311 0.19
312 0.19
313 0.17
314 0.15
315 0.16
316 0.16
317 0.14
318 0.13
319 0.09
320 0.09
321 0.09
322 0.09
323 0.07
324 0.07
325 0.08
326 0.1
327 0.14
328 0.15
329 0.15
330 0.17
331 0.18
332 0.26
333 0.32
334 0.35
335 0.38
336 0.42
337 0.48
338 0.49
339 0.52
340 0.53
341 0.49
342 0.53
343 0.5
344 0.53
345 0.48
346 0.47
347 0.45
348 0.36
349 0.33
350 0.24
351 0.21
352 0.14
353 0.13
354 0.11
355 0.1
356 0.1
357 0.09
358 0.11
359 0.13
360 0.17
361 0.17