Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1Y1X8A9

Protein Details
Accession A0A1Y1X8A9    Localization Confidence Low Confidence Score 8.4
NoLS Segment(s)
PositionSequenceProtein Nature
172-195LDYLREYKRLNKHNKKYIENKGLRHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 13, cyto_nucl 12.5, cyto 10, mito 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR002110  Ankyrin_rpt  
IPR036770  Ankyrin_rpt-contain_sf  
Amino Acid Sequences MYSNIFRELYDLVLNGNLTNEENNVFRLITDDNVSELDKYLGRNNISLKQINSSGDKTGFDVLILALKTKASLDMIKYIVNKTPYKDLNYGLVKDKNNFEVPLFIAIANNDFQVADYLISKGASLEYNFKSEPWNTGTDYVNINKSNNLPYYSMEGQGLDLDYYYNINANLLDYLREYKRLNKHNKKYIENKGLRVDINLHEKKADDYRERLIKKYMMN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.14
2 0.12
3 0.11
4 0.1
5 0.1
6 0.1
7 0.11
8 0.11
9 0.12
10 0.13
11 0.13
12 0.12
13 0.11
14 0.13
15 0.13
16 0.13
17 0.14
18 0.13
19 0.13
20 0.15
21 0.15
22 0.13
23 0.13
24 0.13
25 0.12
26 0.13
27 0.17
28 0.21
29 0.21
30 0.24
31 0.27
32 0.31
33 0.34
34 0.36
35 0.32
36 0.31
37 0.32
38 0.32
39 0.32
40 0.28
41 0.26
42 0.24
43 0.23
44 0.21
45 0.2
46 0.17
47 0.13
48 0.12
49 0.09
50 0.11
51 0.1
52 0.09
53 0.08
54 0.08
55 0.08
56 0.08
57 0.09
58 0.07
59 0.09
60 0.1
61 0.14
62 0.15
63 0.17
64 0.18
65 0.19
66 0.2
67 0.23
68 0.23
69 0.21
70 0.28
71 0.28
72 0.31
73 0.32
74 0.3
75 0.32
76 0.33
77 0.33
78 0.31
79 0.33
80 0.3
81 0.3
82 0.31
83 0.26
84 0.25
85 0.24
86 0.2
87 0.16
88 0.15
89 0.15
90 0.13
91 0.1
92 0.09
93 0.08
94 0.09
95 0.08
96 0.07
97 0.05
98 0.05
99 0.05
100 0.05
101 0.05
102 0.05
103 0.05
104 0.05
105 0.06
106 0.06
107 0.05
108 0.05
109 0.05
110 0.06
111 0.06
112 0.12
113 0.12
114 0.15
115 0.15
116 0.15
117 0.17
118 0.17
119 0.19
120 0.17
121 0.18
122 0.16
123 0.19
124 0.2
125 0.2
126 0.22
127 0.2
128 0.22
129 0.21
130 0.2
131 0.19
132 0.2
133 0.22
134 0.22
135 0.22
136 0.19
137 0.19
138 0.25
139 0.25
140 0.24
141 0.2
142 0.18
143 0.16
144 0.15
145 0.14
146 0.08
147 0.06
148 0.06
149 0.06
150 0.06
151 0.06
152 0.06
153 0.06
154 0.06
155 0.06
156 0.07
157 0.08
158 0.08
159 0.08
160 0.09
161 0.14
162 0.15
163 0.19
164 0.2
165 0.27
166 0.36
167 0.46
168 0.56
169 0.62
170 0.72
171 0.77
172 0.84
173 0.84
174 0.85
175 0.85
176 0.85
177 0.8
178 0.75
179 0.72
180 0.68
181 0.59
182 0.52
183 0.45
184 0.4
185 0.45
186 0.42
187 0.36
188 0.33
189 0.34
190 0.36
191 0.39
192 0.41
193 0.37
194 0.38
195 0.46
196 0.55
197 0.57
198 0.56
199 0.55