Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y1WYM0

Protein Details
Accession A0A1Y1WYM0    Localization Confidence Low Confidence Score 5.3
NoLS Segment(s)
PositionSequenceProtein Nature
353-403KTTTTTKKTTTTKKTTTTKKTTTTKKTTTTTKKTTTTTKKNTATTKKVTKVHydrophilic
NLS Segment(s)
Subcellular Location(s) extr 16, golg 4, vacu 2, nucl 1, mito 1, cyto 1, plas 1, cyto_nucl 1, E.R. 1, cyto_mito 1, mito_nucl 1
Family & Domain DBs
InterPro View protein in InterPro  
IPR013785  Aldolase_TIM  
IPR004352  GH114_TIM-barrel  
IPR017853  Glycoside_hydrolase_SF  
Gene Ontology GO:0052692  F:raffinose alpha-galactosidase activity  
Pfam View protein in Pfam  
PF03537  Glyco_hydro_114  
Amino Acid Sequences MKFILPITFLTSLIIFNTVEAALWLPKPGTTWNYVLGSDVDETKETAQAVDIDVRKSTSKIEALHNHGIKVICYFSGGTAENFRDDYQDFLKIPNLVQDRYEDWPEEFWLDFRIEGVKPLIKKRMQLAISKKCDAIEVDNLDGYQMDVVKKWKNPLTKADTIKYAKWLGTTAHELGISIGLKNVLGILDDITDYFDFAINEECIDYNECYLYKNFLNKGKAVFGVTYNGLEKNKEALCRNLNGLPISMIIKSSTKLVQDGITFDGKKHCGSSFNTGLAASSNNLANNKVTTTIKKTTTTVKKTTTTTKKPTTTTTVKKTTTTTKKTTTTTKKTTTTTKKPTTTTKKTTTTTKKTTTTTKKTTTTKKTTTTKKTTTTKKTTTTTKKTTTTTKKNTATTKKVTKVIKVVTVVKKKSS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.16
2 0.11
3 0.09
4 0.11
5 0.1
6 0.09
7 0.09
8 0.1
9 0.1
10 0.11
11 0.12
12 0.11
13 0.11
14 0.13
15 0.18
16 0.2
17 0.22
18 0.24
19 0.28
20 0.29
21 0.29
22 0.29
23 0.25
24 0.23
25 0.2
26 0.19
27 0.15
28 0.14
29 0.15
30 0.14
31 0.16
32 0.14
33 0.13
34 0.13
35 0.12
36 0.13
37 0.19
38 0.2
39 0.19
40 0.2
41 0.22
42 0.22
43 0.22
44 0.22
45 0.21
46 0.24
47 0.26
48 0.34
49 0.39
50 0.46
51 0.54
52 0.53
53 0.48
54 0.46
55 0.43
56 0.35
57 0.29
58 0.23
59 0.13
60 0.13
61 0.13
62 0.1
63 0.14
64 0.14
65 0.14
66 0.17
67 0.18
68 0.18
69 0.19
70 0.19
71 0.18
72 0.17
73 0.19
74 0.17
75 0.21
76 0.2
77 0.2
78 0.23
79 0.21
80 0.21
81 0.24
82 0.26
83 0.22
84 0.22
85 0.24
86 0.24
87 0.27
88 0.29
89 0.22
90 0.2
91 0.2
92 0.21
93 0.2
94 0.17
95 0.13
96 0.13
97 0.12
98 0.11
99 0.11
100 0.13
101 0.11
102 0.13
103 0.15
104 0.16
105 0.19
106 0.24
107 0.32
108 0.31
109 0.34
110 0.36
111 0.42
112 0.42
113 0.46
114 0.51
115 0.53
116 0.57
117 0.56
118 0.52
119 0.44
120 0.42
121 0.36
122 0.29
123 0.25
124 0.21
125 0.2
126 0.2
127 0.19
128 0.18
129 0.16
130 0.13
131 0.07
132 0.06
133 0.06
134 0.08
135 0.12
136 0.16
137 0.18
138 0.24
139 0.28
140 0.33
141 0.36
142 0.44
143 0.48
144 0.52
145 0.54
146 0.51
147 0.53
148 0.5
149 0.47
150 0.42
151 0.36
152 0.28
153 0.24
154 0.23
155 0.17
156 0.17
157 0.19
158 0.16
159 0.15
160 0.15
161 0.14
162 0.13
163 0.14
164 0.11
165 0.07
166 0.07
167 0.06
168 0.06
169 0.06
170 0.06
171 0.04
172 0.04
173 0.04
174 0.04
175 0.04
176 0.04
177 0.04
178 0.05
179 0.05
180 0.05
181 0.05
182 0.06
183 0.05
184 0.06
185 0.08
186 0.06
187 0.07
188 0.07
189 0.07
190 0.06
191 0.08
192 0.08
193 0.06
194 0.07
195 0.07
196 0.08
197 0.08
198 0.1
199 0.11
200 0.15
201 0.18
202 0.23
203 0.25
204 0.25
205 0.26
206 0.25
207 0.24
208 0.21
209 0.18
210 0.13
211 0.13
212 0.12
213 0.11
214 0.11
215 0.12
216 0.12
217 0.11
218 0.11
219 0.14
220 0.15
221 0.18
222 0.19
223 0.22
224 0.24
225 0.26
226 0.28
227 0.25
228 0.25
229 0.22
230 0.2
231 0.16
232 0.14
233 0.13
234 0.11
235 0.09
236 0.08
237 0.08
238 0.08
239 0.1
240 0.11
241 0.11
242 0.12
243 0.12
244 0.13
245 0.13
246 0.15
247 0.15
248 0.17
249 0.16
250 0.16
251 0.2
252 0.19
253 0.19
254 0.2
255 0.18
256 0.19
257 0.22
258 0.29
259 0.27
260 0.27
261 0.27
262 0.25
263 0.24
264 0.2
265 0.18
266 0.11
267 0.09
268 0.09
269 0.1
270 0.11
271 0.11
272 0.12
273 0.12
274 0.12
275 0.14
276 0.15
277 0.17
278 0.23
279 0.28
280 0.31
281 0.32
282 0.34
283 0.4
284 0.48
285 0.52
286 0.52
287 0.51
288 0.52
289 0.54
290 0.63
291 0.63
292 0.62
293 0.64
294 0.66
295 0.66
296 0.64
297 0.66
298 0.64
299 0.63
300 0.63
301 0.63
302 0.62
303 0.59
304 0.58
305 0.57
306 0.59
307 0.6
308 0.58
309 0.56
310 0.55
311 0.58
312 0.61
313 0.67
314 0.68
315 0.67
316 0.68
317 0.68
318 0.67
319 0.65
320 0.72
321 0.72
322 0.72
323 0.72
324 0.73
325 0.71
326 0.7
327 0.77
328 0.77
329 0.77
330 0.75
331 0.74
332 0.72
333 0.71
334 0.76
335 0.76
336 0.75
337 0.73
338 0.72
339 0.68
340 0.65
341 0.72
342 0.72
343 0.71
344 0.7
345 0.68
346 0.7
347 0.73
348 0.79
349 0.79
350 0.79
351 0.77
352 0.78
353 0.8
354 0.82
355 0.84
356 0.83
357 0.8
358 0.8
359 0.82
360 0.83
361 0.84
362 0.83
363 0.8
364 0.78
365 0.77
366 0.78
367 0.79
368 0.79
369 0.77
370 0.74
371 0.72
372 0.68
373 0.72
374 0.72
375 0.73
376 0.73
377 0.75
378 0.75
379 0.77
380 0.83
381 0.83
382 0.81
383 0.8
384 0.8
385 0.77
386 0.77
387 0.75
388 0.72
389 0.7
390 0.67
391 0.64
392 0.59
393 0.61
394 0.64
395 0.69