Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y1WRB7

Protein Details
Accession A0A1Y1WRB7   
Localization Confidence Low
Confidence Score 8.7
NoLS Segment(s)
PositionSequenceProtein Nature
77-97NINNNNYKNNNKNNNNSNNNKHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 13, nucl 10, cyto 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR001609  Myosin_head_motor_dom  
IPR027417  P-loop_NTPase  
Gene Ontology GO:0016459  C:myosin complex  
GO:0003779  F:actin binding  
GO:0005524  F:ATP binding  
GO:0003774  F:cytoskeletal motor activity  
PROSITE View protein in PROSITE  
PS51456  MYOSIN_MOTOR  
Amino Acid Sequences MGYTIRILYKDFISRYMICVNSSDVAFLKEKEAVVTILKEVNASKEHCQCGKTKEFMKTELENKLESRREKKLMNNNINNNNYKNNNKNNNNSNNNK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.28
2 0.29
3 0.32
4 0.29
5 0.24
6 0.24
7 0.24
8 0.2
9 0.2
10 0.17
11 0.13
12 0.14
13 0.14
14 0.14
15 0.13
16 0.13
17 0.13
18 0.12
19 0.13
20 0.11
21 0.11
22 0.11
23 0.1
24 0.1
25 0.1
26 0.1
27 0.09
28 0.11
29 0.12
30 0.14
31 0.17
32 0.21
33 0.23
34 0.24
35 0.25
36 0.25
37 0.29
38 0.31
39 0.32
40 0.31
41 0.36
42 0.37
43 0.38
44 0.4
45 0.39
46 0.38
47 0.39
48 0.36
49 0.3
50 0.29
51 0.33
52 0.35
53 0.36
54 0.38
55 0.39
56 0.43
57 0.46
58 0.53
59 0.57
60 0.62
61 0.67
62 0.7
63 0.72
64 0.76
65 0.77
66 0.73
67 0.65
68 0.61
69 0.57
70 0.57
71 0.57
72 0.59
73 0.64
74 0.68
75 0.75
76 0.78
77 0.82