Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y1XRJ7

Protein Details
Accession A0A1Y1XRJ7    Localization Confidence Low Confidence Score 7.5
NoLS Segment(s)
PositionSequenceProtein Nature
8-27NLNKLKNKSIMNKNNDNKNPHydrophilic
NLS Segment(s)
Subcellular Location(s) plas 11, nucl 7, mito 5, cyto_nucl 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR019328  GPI-GlcNAc_Trfase_PIG-H_dom  
IPR044215  PIG-H  
Gene Ontology GO:0000506  C:glycosylphosphatidylinositol-N-acetylglucosaminyltransferase (GPI-GnT) complex  
GO:0006506  P:GPI anchor biosynthetic process  
Pfam View protein in Pfam  
PF10181  PIG-H  
Amino Acid Sequences MSNLNTNNLNKLKNKSIMNKNNDNKNPINSQNNNDLNSPINIINNNLKKNKKNEPEFIYKIHADNAHEFIMKSTSRLISNFDIFIIIILTFLMCLCFMKKHIILSFLVIILFLLFGYIKSNTIIEESLLVVRDLGVQIKTTYLFNRTTSRFIDKSKIGQIIINEGITAFEVNFYLAVLISGADHMEVVYKKLIPKLKILKFIYKESNEILKPNFLKDQLGLL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.58
2 0.6
3 0.66
4 0.71
5 0.74
6 0.78
7 0.78
8 0.82
9 0.79
10 0.76
11 0.69
12 0.65
13 0.63
14 0.6
15 0.62
16 0.56
17 0.55
18 0.59
19 0.59
20 0.55
21 0.49
22 0.43
23 0.36
24 0.32
25 0.3
26 0.21
27 0.18
28 0.17
29 0.19
30 0.26
31 0.3
32 0.35
33 0.4
34 0.46
35 0.5
36 0.57
37 0.64
38 0.65
39 0.67
40 0.69
41 0.69
42 0.71
43 0.68
44 0.63
45 0.58
46 0.49
47 0.43
48 0.38
49 0.33
50 0.26
51 0.25
52 0.25
53 0.22
54 0.21
55 0.2
56 0.17
57 0.19
58 0.16
59 0.14
60 0.14
61 0.14
62 0.15
63 0.16
64 0.19
65 0.18
66 0.2
67 0.19
68 0.17
69 0.15
70 0.13
71 0.13
72 0.09
73 0.06
74 0.04
75 0.04
76 0.03
77 0.03
78 0.03
79 0.03
80 0.03
81 0.03
82 0.04
83 0.05
84 0.06
85 0.11
86 0.12
87 0.15
88 0.16
89 0.17
90 0.17
91 0.17
92 0.17
93 0.12
94 0.11
95 0.08
96 0.07
97 0.05
98 0.05
99 0.03
100 0.02
101 0.02
102 0.02
103 0.04
104 0.04
105 0.05
106 0.06
107 0.06
108 0.06
109 0.07
110 0.07
111 0.06
112 0.06
113 0.06
114 0.07
115 0.07
116 0.07
117 0.05
118 0.05
119 0.06
120 0.06
121 0.06
122 0.06
123 0.06
124 0.07
125 0.07
126 0.08
127 0.09
128 0.1
129 0.12
130 0.14
131 0.16
132 0.21
133 0.23
134 0.25
135 0.27
136 0.33
137 0.32
138 0.33
139 0.36
140 0.33
141 0.35
142 0.37
143 0.37
144 0.31
145 0.3
146 0.28
147 0.27
148 0.26
149 0.21
150 0.15
151 0.13
152 0.12
153 0.11
154 0.11
155 0.05
156 0.04
157 0.05
158 0.05
159 0.05
160 0.05
161 0.04
162 0.04
163 0.04
164 0.04
165 0.04
166 0.04
167 0.04
168 0.04
169 0.04
170 0.04
171 0.04
172 0.08
173 0.08
174 0.1
175 0.12
176 0.14
177 0.16
178 0.23
179 0.29
180 0.27
181 0.37
182 0.45
183 0.5
184 0.57
185 0.6
186 0.63
187 0.61
188 0.66
189 0.66
190 0.58
191 0.55
192 0.49
193 0.53
194 0.45
195 0.45
196 0.4
197 0.39
198 0.38
199 0.39
200 0.4
201 0.33
202 0.34