Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1Y1WVF1

Protein Details
Accession A0A1Y1WVF1    Localization Confidence Medium Confidence Score 14.9
NoLS Segment(s)
PositionSequenceProtein Nature
99-137SKAYSSNKKHDIKKVKSKLRDGLKKIKNRNKNSNKNNKSHydrophilic
NLS Segment(s)
PositionSequence
106-137KKHDIKKVKSKLRDGLKKIKNRNKNSNKNNKS
Subcellular Location(s) nucl 20, mito 3, cyto 3, cyto_mito 3
Family & Domain DBs
Amino Acid Sequences MTVKAKSDPTKNPSYKNLANSKYDLFPEEVNRSLIFLNIQMPLKHLVNRTSKDHLVAKELVSNILDNIDVLNTESFDDITYDSIVGTNPNKSSNSNALSKAYSSNKKHDIKKVKSKLRDGLKKIKNRNKNSNKNNKS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.66
2 0.64
3 0.64
4 0.66
5 0.6
6 0.59
7 0.56
8 0.52
9 0.46
10 0.42
11 0.35
12 0.28
13 0.26
14 0.27
15 0.27
16 0.26
17 0.24
18 0.23
19 0.22
20 0.2
21 0.18
22 0.13
23 0.11
24 0.11
25 0.12
26 0.14
27 0.13
28 0.14
29 0.17
30 0.18
31 0.21
32 0.21
33 0.25
34 0.31
35 0.34
36 0.37
37 0.39
38 0.38
39 0.38
40 0.4
41 0.34
42 0.31
43 0.29
44 0.24
45 0.22
46 0.22
47 0.19
48 0.14
49 0.13
50 0.09
51 0.08
52 0.08
53 0.04
54 0.04
55 0.04
56 0.03
57 0.04
58 0.04
59 0.04
60 0.04
61 0.04
62 0.04
63 0.05
64 0.05
65 0.05
66 0.06
67 0.06
68 0.05
69 0.05
70 0.05
71 0.05
72 0.07
73 0.08
74 0.1
75 0.11
76 0.13
77 0.14
78 0.15
79 0.2
80 0.24
81 0.26
82 0.27
83 0.28
84 0.28
85 0.28
86 0.27
87 0.29
88 0.3
89 0.35
90 0.36
91 0.42
92 0.49
93 0.56
94 0.62
95 0.67
96 0.7
97 0.71
98 0.78
99 0.81
100 0.82
101 0.83
102 0.83
103 0.82
104 0.82
105 0.82
106 0.79
107 0.79
108 0.78
109 0.8
110 0.83
111 0.85
112 0.84
113 0.84
114 0.88
115 0.88
116 0.9
117 0.92