Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y1XQ74

Protein Details
Accession A0A1Y1XQ74   
Localization Confidence Medium
Confidence Score 11
NoLS Segment(s)
PositionSequenceProtein Nature
123-154ENNNDKKNEIKSKKNHKNKNNENDDNKNKKKEHydrophilic
NLS Segment(s)
PositionSequence
133-141KSKKNHKNK
Subcellular Location(s) nucl 12.5, cyto_nucl 12.333, cyto 11, cyto_pero 6.333
Family & Domain DBs
Amino Acid Sequences MEIPLRNTSPYEEDWEEQFADAAEDSEEEIEELKNHLNEVITFNNDEIEDDYDDYDSEEEYFNEINYDELFGDATSDFTKQYNKIKKINSIYNNTNAEKNVNTSKFSDGEKEKENEEDNEILENNNDKKNEIKSKKNHKNKNNENDDNKNKKKEIIEKNKQIENELSEKYSNRIHIGKI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.3
2 0.32
3 0.29
4 0.24
5 0.22
6 0.15
7 0.13
8 0.11
9 0.09
10 0.07
11 0.07
12 0.07
13 0.07
14 0.07
15 0.06
16 0.06
17 0.06
18 0.07
19 0.08
20 0.1
21 0.1
22 0.11
23 0.11
24 0.11
25 0.12
26 0.15
27 0.17
28 0.16
29 0.16
30 0.16
31 0.16
32 0.15
33 0.14
34 0.12
35 0.12
36 0.11
37 0.11
38 0.11
39 0.11
40 0.11
41 0.1
42 0.09
43 0.06
44 0.06
45 0.06
46 0.06
47 0.08
48 0.08
49 0.07
50 0.08
51 0.07
52 0.07
53 0.07
54 0.07
55 0.05
56 0.05
57 0.06
58 0.05
59 0.06
60 0.05
61 0.06
62 0.06
63 0.06
64 0.07
65 0.07
66 0.1
67 0.12
68 0.21
69 0.29
70 0.34
71 0.4
72 0.42
73 0.49
74 0.52
75 0.57
76 0.54
77 0.51
78 0.48
79 0.49
80 0.5
81 0.43
82 0.39
83 0.31
84 0.27
85 0.21
86 0.22
87 0.22
88 0.19
89 0.2
90 0.2
91 0.22
92 0.23
93 0.23
94 0.26
95 0.22
96 0.24
97 0.27
98 0.27
99 0.26
100 0.26
101 0.28
102 0.23
103 0.23
104 0.2
105 0.16
106 0.16
107 0.16
108 0.13
109 0.12
110 0.15
111 0.15
112 0.18
113 0.18
114 0.17
115 0.21
116 0.28
117 0.38
118 0.41
119 0.48
120 0.55
121 0.66
122 0.76
123 0.83
124 0.85
125 0.84
126 0.88
127 0.89
128 0.9
129 0.89
130 0.88
131 0.85
132 0.85
133 0.87
134 0.86
135 0.83
136 0.79
137 0.7
138 0.66
139 0.66
140 0.66
141 0.67
142 0.68
143 0.71
144 0.74
145 0.79
146 0.78
147 0.71
148 0.64
149 0.57
150 0.51
151 0.46
152 0.38
153 0.34
154 0.32
155 0.33
156 0.32
157 0.33
158 0.31
159 0.3