Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1Y1X5X0

Protein Details
Accession A0A1Y1X5X0    Localization Confidence Medium Confidence Score 11
NoLS Segment(s)
PositionSequenceProtein Nature
213-235LTACITYCCRHKKNKKRRAKISLHydrophilic
NLS Segment(s)
PositionSequence
223-233HKKNKKRRAKI
Subcellular Location(s) nucl 8, E.R. 6, cyto 3, mito 2, plas 2, pero 2, golg 2, vacu 2
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MRESKKNFFYVTLFYFIIIFIYGNCENLSKDEVLNIKLKKNLRKCPSYSDGYSNYSCEYHFYCRGDDCSTKVEKDSRVYFYNTDGKIESFIPDTCNEESIQENNCTTVKCYNDLDCLSNKCINNTCLVNDDLPVIQCMNIESYNSFKFKYKATMNCGKSDYEKCIDNTDCASNNCTESGYCIFNHEEHYADQFFYQFFEIGVIIFVCLFIVFLTACITYCCRHKKNKKRRAKISL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.27
2 0.26
3 0.22
4 0.19
5 0.14
6 0.1
7 0.06
8 0.12
9 0.12
10 0.13
11 0.13
12 0.14
13 0.14
14 0.16
15 0.19
16 0.14
17 0.14
18 0.18
19 0.2
20 0.22
21 0.28
22 0.28
23 0.29
24 0.34
25 0.4
26 0.46
27 0.53
28 0.6
29 0.62
30 0.68
31 0.67
32 0.7
33 0.69
34 0.66
35 0.6
36 0.57
37 0.52
38 0.49
39 0.46
40 0.38
41 0.34
42 0.27
43 0.24
44 0.2
45 0.19
46 0.2
47 0.25
48 0.25
49 0.26
50 0.27
51 0.3
52 0.31
53 0.3
54 0.26
55 0.26
56 0.27
57 0.26
58 0.27
59 0.28
60 0.27
61 0.31
62 0.33
63 0.32
64 0.33
65 0.34
66 0.32
67 0.32
68 0.37
69 0.31
70 0.29
71 0.25
72 0.22
73 0.22
74 0.21
75 0.18
76 0.11
77 0.12
78 0.12
79 0.12
80 0.15
81 0.14
82 0.14
83 0.13
84 0.13
85 0.13
86 0.14
87 0.16
88 0.13
89 0.13
90 0.13
91 0.14
92 0.13
93 0.13
94 0.15
95 0.14
96 0.15
97 0.17
98 0.16
99 0.19
100 0.2
101 0.2
102 0.19
103 0.2
104 0.2
105 0.23
106 0.22
107 0.21
108 0.23
109 0.21
110 0.22
111 0.2
112 0.18
113 0.16
114 0.17
115 0.15
116 0.12
117 0.13
118 0.1
119 0.1
120 0.09
121 0.07
122 0.06
123 0.06
124 0.06
125 0.07
126 0.07
127 0.07
128 0.07
129 0.1
130 0.13
131 0.14
132 0.15
133 0.15
134 0.17
135 0.18
136 0.25
137 0.28
138 0.32
139 0.38
140 0.47
141 0.47
142 0.49
143 0.49
144 0.43
145 0.41
146 0.38
147 0.35
148 0.28
149 0.29
150 0.26
151 0.3
152 0.3
153 0.27
154 0.26
155 0.25
156 0.25
157 0.24
158 0.25
159 0.2
160 0.2
161 0.19
162 0.17
163 0.14
164 0.14
165 0.16
166 0.15
167 0.14
168 0.16
169 0.17
170 0.17
171 0.21
172 0.19
173 0.18
174 0.17
175 0.21
176 0.19
177 0.18
178 0.18
179 0.15
180 0.14
181 0.13
182 0.14
183 0.09
184 0.08
185 0.09
186 0.09
187 0.08
188 0.09
189 0.07
190 0.06
191 0.06
192 0.05
193 0.04
194 0.04
195 0.04
196 0.03
197 0.05
198 0.04
199 0.05
200 0.07
201 0.07
202 0.08
203 0.09
204 0.12
205 0.14
206 0.22
207 0.32
208 0.38
209 0.49
210 0.6
211 0.7
212 0.79
213 0.87
214 0.9
215 0.91