Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

B8PI65

Protein Details
Accession B8PI65    Localization Confidence Low Confidence Score 9.5
NoLS Segment(s)
PositionSequenceProtein Nature
111-130QIPKRHTKKHDDQSPLPPGPBasic
NLS Segment(s)
Subcellular Location(s) nucl 16.5, cyto_nucl 12.5, cyto 7.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR022533  Cox20  
Gene Ontology GO:0005743  C:mitochondrial inner membrane  
GO:0033617  P:mitochondrial cytochrome c oxidase assembly  
KEGG ppl:POSPLDRAFT_98953  -  
Pfam View protein in Pfam  
PF12597  Cox20  
Amino Acid Sequences MSSSSDPETTPTTSSSSNKKIVFQTETTGSYWSDVKEAIKKIGEIPCARNSLLSGIASGAGVGVIRGMSAGPFWASQWAVGTFVLISMGTWTICRKSMEEERRRIQQVVEQIPKRHTKKHDDQSPLPPGPQS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.27
2 0.33
3 0.36
4 0.41
5 0.41
6 0.44
7 0.45
8 0.47
9 0.47
10 0.4
11 0.38
12 0.35
13 0.36
14 0.32
15 0.29
16 0.23
17 0.2
18 0.2
19 0.16
20 0.13
21 0.12
22 0.13
23 0.18
24 0.19
25 0.21
26 0.21
27 0.21
28 0.25
29 0.28
30 0.31
31 0.27
32 0.3
33 0.31
34 0.32
35 0.32
36 0.27
37 0.23
38 0.2
39 0.19
40 0.14
41 0.1
42 0.08
43 0.08
44 0.07
45 0.06
46 0.05
47 0.03
48 0.03
49 0.02
50 0.02
51 0.02
52 0.02
53 0.02
54 0.02
55 0.02
56 0.02
57 0.03
58 0.03
59 0.04
60 0.04
61 0.06
62 0.06
63 0.06
64 0.08
65 0.08
66 0.08
67 0.08
68 0.08
69 0.06
70 0.06
71 0.06
72 0.04
73 0.04
74 0.04
75 0.04
76 0.04
77 0.05
78 0.07
79 0.08
80 0.11
81 0.12
82 0.13
83 0.19
84 0.3
85 0.4
86 0.48
87 0.54
88 0.57
89 0.63
90 0.66
91 0.6
92 0.51
93 0.45
94 0.45
95 0.46
96 0.51
97 0.48
98 0.48
99 0.53
100 0.62
101 0.61
102 0.6
103 0.59
104 0.6
105 0.66
106 0.73
107 0.76
108 0.75
109 0.78
110 0.79
111 0.81
112 0.72