Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y1WK36

Protein Details
Accession A0A1Y1WK36    Localization Confidence Medium Confidence Score 11.1
NoLS Segment(s)
PositionSequenceProtein Nature
44-64TTKKSTKSTKKSKSTSTKKKIHydrophilic
NLS Segment(s)
PositionSequence
50-57KSTKKSKS
Subcellular Location(s) mito 12, nucl 11, cyto_nucl 8.5, cyto 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR001002  Chitin-bd_1  
IPR018371  Chitin-binding_1_CS  
IPR036861  Endochitinase-like_sf  
Gene Ontology GO:0008061  F:chitin binding  
Pfam View protein in Pfam  
PF00187  Chitin_bind_1  
PROSITE View protein in PROSITE  
PS00026  CHIT_BIND_I_1  
PS50941  CHIT_BIND_I_2  
Amino Acid Sequences CSKGYCCSKYGYCGTDSTYCDNGCQNEFGTCNIKPTKTTKSTNTTKKSTKSTKKSKSTSTKKKIPTSTINGRCGPNYGACAKEGYCCSKYNYCGKDSDYCGNGCQSDYGFC
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.36
2 0.36
3 0.35
4 0.34
5 0.32
6 0.3
7 0.29
8 0.3
9 0.28
10 0.24
11 0.23
12 0.19
13 0.17
14 0.18
15 0.19
16 0.2
17 0.18
18 0.22
19 0.23
20 0.23
21 0.24
22 0.28
23 0.34
24 0.37
25 0.42
26 0.42
27 0.48
28 0.57
29 0.64
30 0.65
31 0.63
32 0.62
33 0.62
34 0.64
35 0.65
36 0.67
37 0.67
38 0.72
39 0.75
40 0.78
41 0.78
42 0.79
43 0.79
44 0.8
45 0.81
46 0.79
47 0.78
48 0.76
49 0.8
50 0.75
51 0.7
52 0.66
53 0.63
54 0.65
55 0.64
56 0.61
57 0.56
58 0.53
59 0.47
60 0.42
61 0.35
62 0.26
63 0.22
64 0.19
65 0.17
66 0.17
67 0.18
68 0.16
69 0.18
70 0.2
71 0.23
72 0.23
73 0.24
74 0.29
75 0.33
76 0.37
77 0.43
78 0.44
79 0.4
80 0.41
81 0.43
82 0.45
83 0.44
84 0.46
85 0.39
86 0.37
87 0.36
88 0.36
89 0.33
90 0.26
91 0.23