Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1X2IRV0

Protein Details
Accession A0A1X2IRV0    Localization Confidence Medium Confidence Score 13.9
NoLS Segment(s)
PositionSequenceProtein Nature
8-60MNKIKGPSLEKRKRIQKARRATSKPAPSVTASKNLSRKKQKKVEKALRNEKNYHydrophilic
NLS Segment(s)
PositionSequence
11-53IKGPSLEKRKRIQKARRATSKPAPSVTASKNLSRKKQKKVEKA
Subcellular Location(s) nucl 22.5, cyto_nucl 12.5, mito 3
Family & Domain DBs
Amino Acid Sequences MAISKSNMNKIKGPSLEKRKRIQKARRATSKPAPSVTASKNLSRKKQKKVEKALRNEKNYLVSRGLIDHEEEMKDVIEVPREKQRVVVTIPEEILAASAAGPGTTLGGML
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.55
2 0.61
3 0.67
4 0.69
5 0.74
6 0.76
7 0.8
8 0.83
9 0.84
10 0.82
11 0.83
12 0.86
13 0.88
14 0.84
15 0.82
16 0.81
17 0.79
18 0.74
19 0.65
20 0.57
21 0.49
22 0.49
23 0.43
24 0.41
25 0.34
26 0.36
27 0.41
28 0.44
29 0.51
30 0.56
31 0.62
32 0.64
33 0.71
34 0.75
35 0.78
36 0.83
37 0.85
38 0.82
39 0.85
40 0.85
41 0.84
42 0.78
43 0.69
44 0.6
45 0.56
46 0.49
47 0.42
48 0.32
49 0.24
50 0.21
51 0.2
52 0.2
53 0.13
54 0.12
55 0.11
56 0.11
57 0.1
58 0.1
59 0.1
60 0.09
61 0.08
62 0.09
63 0.08
64 0.13
65 0.14
66 0.16
67 0.24
68 0.26
69 0.26
70 0.29
71 0.3
72 0.28
73 0.3
74 0.33
75 0.27
76 0.28
77 0.28
78 0.24
79 0.22
80 0.17
81 0.15
82 0.09
83 0.07
84 0.05
85 0.05
86 0.05
87 0.05
88 0.05
89 0.05
90 0.05