Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1X2IAS9

Protein Details
Accession A0A1X2IAS9   
Localization Confidence Low
Confidence Score 7.3
NoLS Segment(s)
PositionSequenceProtein Nature
49-74QLKTLFKKQNTNHKNKINQHKFHISFHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 18, nucl 6, cyto 2
Family & Domain DBs
Amino Acid Sequences MATCFLIFYFLGANQTAPFAAKSSHSFFPRRYTHSWTITVLMSAILKLQLKTLFKKQNTNHKNKINQHKFHISFDRT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.1
2 0.1
3 0.1
4 0.09
5 0.09
6 0.08
7 0.09
8 0.1
9 0.14
10 0.18
11 0.23
12 0.26
13 0.29
14 0.3
15 0.37
16 0.4
17 0.42
18 0.41
19 0.44
20 0.47
21 0.48
22 0.48
23 0.4
24 0.37
25 0.31
26 0.27
27 0.19
28 0.13
29 0.09
30 0.07
31 0.06
32 0.06
33 0.07
34 0.07
35 0.09
36 0.13
37 0.16
38 0.2
39 0.29
40 0.36
41 0.38
42 0.48
43 0.52
44 0.59
45 0.67
46 0.73
47 0.73
48 0.73
49 0.8
50 0.8
51 0.86
52 0.85
53 0.81
54 0.79
55 0.81
56 0.75
57 0.73