Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1X2I3W3

Protein Details
Accession A0A1X2I3W3    Localization Confidence Low Confidence Score 9.4
NoLS Segment(s)
PositionSequenceProtein Nature
15-40VEIKQKGRPKTQCKKCRELRLVRQLHHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 15, cyto_nucl 10, mito 9
Family & Domain DBs
InterPro View protein in InterPro  
IPR001083  Cu_fist_DNA-bd_dom  
IPR036395  Cu_fist_DNA-bd_dom_sf  
Gene Ontology GO:0005634  C:nucleus  
GO:0005507  F:copper ion binding  
GO:0003677  F:DNA binding  
GO:0003700  F:DNA-binding transcription factor activity  
Pfam View protein in Pfam  
PF00649  Copper-fist  
PROSITE View protein in PROSITE  
PS50073  COPPER_FIST_2  
Amino Acid Sequences GHRATHCKHKDRPMVEIKQKGRPKTQCKKCRELRLVRQLHVKCNCDDDKQLKRTRSTFSSNSGKSWLSEGEGRRATVSY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.73
2 0.73
3 0.74
4 0.68
5 0.69
6 0.72
7 0.68
8 0.67
9 0.67
10 0.69
11 0.71
12 0.78
13 0.77
14 0.79
15 0.84
16 0.83
17 0.84
18 0.83
19 0.82
20 0.81
21 0.82
22 0.78
23 0.7
24 0.71
25 0.61
26 0.59
27 0.55
28 0.47
29 0.37
30 0.39
31 0.39
32 0.32
33 0.35
34 0.35
35 0.38
36 0.44
37 0.5
38 0.48
39 0.51
40 0.52
41 0.53
42 0.51
43 0.5
44 0.45
45 0.46
46 0.51
47 0.48
48 0.46
49 0.44
50 0.39
51 0.33
52 0.32
53 0.25
54 0.19
55 0.23
56 0.24
57 0.3
58 0.32
59 0.32