Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

B8PDF6

Protein Details
Accession B8PDF6    Localization Confidence Medium Confidence Score 10.5
NoLS Segment(s)
PositionSequenceProtein Nature
162-181DSSPSSSKKKRAHDARKLAAHydrophilic
NLS Segment(s)
PositionSequence
169-180KKKRAHDARKLA
Subcellular Location(s) mito 11, nucl 9, cyto_nucl 9, cyto 7
Family & Domain DBs
InterPro View protein in InterPro  
IPR038765  Papain-like_cys_pep_sf  
IPR001394  Peptidase_C19_UCH  
IPR018200  USP_CS  
IPR028889  USP_dom  
Gene Ontology GO:0004843  F:cysteine-type deubiquitinase activity  
GO:0016579  P:protein deubiquitination  
GO:0006511  P:ubiquitin-dependent protein catabolic process  
KEGG ppl:POSPLDRAFT_20734  -  
Pfam View protein in Pfam  
PF00443  UCH  
PROSITE View protein in PROSITE  
PS00973  USP_2  
PS50235  USP_3  
CDD cd02662  Peptidase_C19F  
Amino Acid Sequences AIRPIDIINALSNHSSGKHNSLFSSREHQDAQELFQLLSECIKNEATAVDKEGYRDRGLGALAQGQGRAGREIGKSVFDGLTANRRSCVECGYTEAVMHFAFDNWQLAVPRLASSCRLEDCLEEYTRLELLTDCICRKCSMLATYQRLVQEAERLAEALRTDSSPSSSKKKRAHDARKLAARVKAAIDDSRMEEDIKGVKLEKVFSKASTKQAMIARPPRVLALHLNRSMHYGHYAAKNNCRVQFPEILDLTPYTTSGQLSTVPSVPISTPPPPIPRSTTPTPAAYATPRTLYRLAAVVCHYGQHSFGHYVCFRRNPRPPSAGTRRFAPPKLACPLGCECELCVPYGPIRDEEGPPPIPGRGWLRISDDSVREVGIESVLQEGSGAFMLFYERVVMPRPSIYLSHTPRSSEETLRPD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.17
2 0.2
3 0.2
4 0.26
5 0.29
6 0.3
7 0.33
8 0.37
9 0.37
10 0.37
11 0.43
12 0.37
13 0.37
14 0.37
15 0.35
16 0.37
17 0.36
18 0.35
19 0.32
20 0.31
21 0.26
22 0.26
23 0.27
24 0.2
25 0.22
26 0.2
27 0.15
28 0.16
29 0.17
30 0.15
31 0.14
32 0.16
33 0.15
34 0.16
35 0.19
36 0.19
37 0.2
38 0.22
39 0.27
40 0.29
41 0.26
42 0.26
43 0.23
44 0.22
45 0.22
46 0.21
47 0.16
48 0.17
49 0.18
50 0.17
51 0.17
52 0.15
53 0.17
54 0.16
55 0.16
56 0.12
57 0.15
58 0.15
59 0.19
60 0.19
61 0.19
62 0.18
63 0.2
64 0.19
65 0.15
66 0.16
67 0.14
68 0.22
69 0.23
70 0.24
71 0.23
72 0.24
73 0.26
74 0.26
75 0.28
76 0.22
77 0.19
78 0.24
79 0.25
80 0.24
81 0.22
82 0.21
83 0.19
84 0.15
85 0.15
86 0.1
87 0.07
88 0.08
89 0.09
90 0.1
91 0.08
92 0.11
93 0.1
94 0.11
95 0.12
96 0.12
97 0.12
98 0.12
99 0.13
100 0.14
101 0.16
102 0.18
103 0.18
104 0.2
105 0.19
106 0.19
107 0.2
108 0.22
109 0.2
110 0.18
111 0.17
112 0.16
113 0.16
114 0.15
115 0.12
116 0.08
117 0.1
118 0.12
119 0.15
120 0.15
121 0.16
122 0.18
123 0.18
124 0.19
125 0.18
126 0.19
127 0.19
128 0.25
129 0.32
130 0.37
131 0.37
132 0.4
133 0.38
134 0.35
135 0.33
136 0.25
137 0.22
138 0.17
139 0.17
140 0.13
141 0.13
142 0.12
143 0.12
144 0.12
145 0.08
146 0.08
147 0.08
148 0.09
149 0.09
150 0.12
151 0.15
152 0.18
153 0.26
154 0.31
155 0.4
156 0.46
157 0.53
158 0.6
159 0.67
160 0.75
161 0.77
162 0.8
163 0.79
164 0.78
165 0.74
166 0.68
167 0.6
168 0.5
169 0.41
170 0.32
171 0.27
172 0.21
173 0.19
174 0.16
175 0.14
176 0.14
177 0.14
178 0.14
179 0.12
180 0.11
181 0.11
182 0.12
183 0.11
184 0.1
185 0.1
186 0.11
187 0.11
188 0.13
189 0.14
190 0.16
191 0.16
192 0.17
193 0.22
194 0.24
195 0.28
196 0.29
197 0.27
198 0.28
199 0.31
200 0.32
201 0.32
202 0.36
203 0.33
204 0.31
205 0.31
206 0.26
207 0.23
208 0.22
209 0.23
210 0.23
211 0.26
212 0.29
213 0.29
214 0.29
215 0.3
216 0.29
217 0.23
218 0.18
219 0.13
220 0.13
221 0.19
222 0.26
223 0.27
224 0.33
225 0.39
226 0.41
227 0.43
228 0.42
229 0.38
230 0.34
231 0.38
232 0.33
233 0.32
234 0.29
235 0.25
236 0.24
237 0.22
238 0.19
239 0.13
240 0.12
241 0.07
242 0.08
243 0.08
244 0.08
245 0.08
246 0.09
247 0.1
248 0.12
249 0.12
250 0.11
251 0.11
252 0.11
253 0.11
254 0.12
255 0.14
256 0.15
257 0.17
258 0.2
259 0.25
260 0.26
261 0.28
262 0.32
263 0.33
264 0.38
265 0.4
266 0.43
267 0.4
268 0.4
269 0.39
270 0.34
271 0.31
272 0.26
273 0.26
274 0.21
275 0.22
276 0.21
277 0.23
278 0.23
279 0.21
280 0.2
281 0.2
282 0.19
283 0.18
284 0.19
285 0.18
286 0.16
287 0.17
288 0.16
289 0.13
290 0.14
291 0.12
292 0.14
293 0.14
294 0.14
295 0.19
296 0.2
297 0.24
298 0.27
299 0.35
300 0.37
301 0.44
302 0.53
303 0.53
304 0.59
305 0.61
306 0.61
307 0.63
308 0.69
309 0.68
310 0.61
311 0.6
312 0.6
313 0.61
314 0.58
315 0.57
316 0.5
317 0.48
318 0.51
319 0.51
320 0.43
321 0.41
322 0.44
323 0.38
324 0.35
325 0.29
326 0.25
327 0.27
328 0.27
329 0.23
330 0.2
331 0.18
332 0.19
333 0.24
334 0.24
335 0.2
336 0.23
337 0.25
338 0.27
339 0.28
340 0.32
341 0.28
342 0.27
343 0.27
344 0.24
345 0.21
346 0.23
347 0.26
348 0.27
349 0.28
350 0.3
351 0.35
352 0.37
353 0.4
354 0.41
355 0.37
356 0.33
357 0.31
358 0.28
359 0.22
360 0.2
361 0.16
362 0.12
363 0.1
364 0.08
365 0.09
366 0.09
367 0.08
368 0.08
369 0.07
370 0.07
371 0.08
372 0.07
373 0.05
374 0.05
375 0.07
376 0.08
377 0.08
378 0.1
379 0.1
380 0.12
381 0.16
382 0.18
383 0.18
384 0.2
385 0.22
386 0.22
387 0.23
388 0.27
389 0.33
390 0.38
391 0.45
392 0.45
393 0.45
394 0.45
395 0.51
396 0.49
397 0.46