Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1X2J2H0

Protein Details
Accession A0A1X2J2H0    Localization Confidence Low Confidence Score 7.5
NoLS Segment(s)
PositionSequenceProtein Nature
20-45GPRPNDKHSTFPKRQKLRGKLRIVTSHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto_nucl 10.833, nucl 10.5, cyto 10, cyto_pero 6.333, mito 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR014752  Arrestin-like_C  
IPR011021  Arrestin-like_N  
Pfam View protein in Pfam  
PF00339  Arrestin_N  
Amino Acid Sequences MTKKIIAVDLEFPNQVEFYGPRPNDKHSTFPKRQKLRGKLRIVTSQPMNLSMVEIRFKGLSQLHWRDPLTHSFLASRMHAGKTLRKSKHILLQNGTIPSGVTDLGFEITIPGYVCSSYQNEYMNVNYTVSAKIMPMAKFAKHVEIERAITIHKTLMPKDIANGLVAGYRVPRCTMRGKRIGSLTWEFKVPKWACLETDIEFDGVLKSLNDQLLVDMIQVDVLQEENYYDGGR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.22
2 0.19
3 0.15
4 0.13
5 0.14
6 0.23
7 0.23
8 0.3
9 0.32
10 0.38
11 0.44
12 0.46
13 0.52
14 0.53
15 0.63
16 0.65
17 0.73
18 0.78
19 0.79
20 0.85
21 0.86
22 0.86
23 0.87
24 0.87
25 0.86
26 0.82
27 0.78
28 0.78
29 0.71
30 0.67
31 0.59
32 0.53
33 0.44
34 0.39
35 0.34
36 0.25
37 0.23
38 0.18
39 0.17
40 0.14
41 0.14
42 0.13
43 0.13
44 0.13
45 0.15
46 0.15
47 0.19
48 0.26
49 0.32
50 0.34
51 0.39
52 0.39
53 0.38
54 0.39
55 0.39
56 0.36
57 0.3
58 0.28
59 0.23
60 0.25
61 0.24
62 0.22
63 0.2
64 0.16
65 0.16
66 0.19
67 0.2
68 0.24
69 0.31
70 0.4
71 0.39
72 0.41
73 0.45
74 0.45
75 0.51
76 0.52
77 0.48
78 0.42
79 0.44
80 0.43
81 0.4
82 0.36
83 0.28
84 0.2
85 0.15
86 0.13
87 0.09
88 0.05
89 0.04
90 0.04
91 0.05
92 0.05
93 0.04
94 0.04
95 0.04
96 0.05
97 0.05
98 0.04
99 0.04
100 0.04
101 0.05
102 0.06
103 0.08
104 0.09
105 0.1
106 0.11
107 0.12
108 0.13
109 0.13
110 0.14
111 0.13
112 0.12
113 0.11
114 0.11
115 0.1
116 0.1
117 0.09
118 0.06
119 0.08
120 0.12
121 0.12
122 0.15
123 0.16
124 0.16
125 0.19
126 0.2
127 0.22
128 0.2
129 0.21
130 0.2
131 0.21
132 0.22
133 0.19
134 0.19
135 0.15
136 0.14
137 0.13
138 0.11
139 0.11
140 0.12
141 0.13
142 0.17
143 0.19
144 0.18
145 0.19
146 0.21
147 0.18
148 0.16
149 0.15
150 0.11
151 0.1
152 0.1
153 0.09
154 0.09
155 0.1
156 0.11
157 0.13
158 0.14
159 0.16
160 0.26
161 0.35
162 0.41
163 0.48
164 0.5
165 0.53
166 0.56
167 0.54
168 0.5
169 0.48
170 0.44
171 0.36
172 0.38
173 0.34
174 0.31
175 0.39
176 0.34
177 0.32
178 0.33
179 0.33
180 0.3
181 0.33
182 0.35
183 0.26
184 0.28
185 0.24
186 0.19
187 0.17
188 0.16
189 0.13
190 0.11
191 0.09
192 0.07
193 0.07
194 0.11
195 0.12
196 0.12
197 0.11
198 0.12
199 0.13
200 0.13
201 0.11
202 0.08
203 0.07
204 0.07
205 0.07
206 0.06
207 0.05
208 0.05
209 0.05
210 0.05
211 0.06
212 0.07