Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1X2IEM5

Protein Details
Accession A0A1X2IEM5   
Localization Confidence Medium
Confidence Score 10
NoLS Segment(s)
PositionSequenceProtein Nature
4-28DKLTAHKEPEKVRKKPKLKSFVLPHBasic
NLS Segment(s)
PositionSequence
13-20EKVRKKPK
Subcellular Location(s) cyto 10.5cyto_nucl 10.5, mito 9, nucl 7.5
Family & Domain DBs
Amino Acid Sequences MPLDKLTAHKEPEKVRKKPKLKSFVLPHTTNSVVVPPMPNLDCQVLFHQFLCALIKGGLLGVFQTGSSMYCIFCLILC
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.65
2 0.71
3 0.77
4 0.81
5 0.84
6 0.86
7 0.85
8 0.8
9 0.8
10 0.78
11 0.78
12 0.76
13 0.67
14 0.59
15 0.53
16 0.48
17 0.39
18 0.3
19 0.21
20 0.14
21 0.13
22 0.12
23 0.08
24 0.1
25 0.1
26 0.1
27 0.1
28 0.11
29 0.1
30 0.11
31 0.13
32 0.14
33 0.14
34 0.14
35 0.13
36 0.12
37 0.12
38 0.13
39 0.1
40 0.09
41 0.08
42 0.08
43 0.08
44 0.08
45 0.07
46 0.06
47 0.05
48 0.05
49 0.05
50 0.05
51 0.05
52 0.05
53 0.05
54 0.08
55 0.08
56 0.08
57 0.08
58 0.09