Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1X2IHS4

Protein Details
Accession A0A1X2IHS4   
Localization Confidence High
Confidence Score 20.4
NoLS Segment(s)
PositionSequenceProtein Nature
8-34MNKVKGPSLERRRRIQKAKRATSKPASHydrophilic
39-60STNLSRKKQKKVEKALRNEKNYHydrophilic
NLS Segment(s)
PositionSequence
12-34KGPSLERRRRIQKAKRATSKPAS
43-52SRKKQKKVEK
Subcellular Location(s) nucl 21, mito 4
Family & Domain DBs
Amino Acid Sequences MAMSKSNMNKVKGPSLERRRRIQKAKRATSKPASAVTASTNLSRKKQKKVEKALRNEKNYLVSRGLIDQEEEMRDVVEVPREKQRVVVTIPEDILAASLAGPGTTLGSMY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.55
2 0.6
3 0.68
4 0.69
5 0.74
6 0.75
7 0.8
8 0.84
9 0.84
10 0.82
11 0.83
12 0.87
13 0.88
14 0.84
15 0.82
16 0.79
17 0.74
18 0.67
19 0.59
20 0.5
21 0.4
22 0.36
23 0.29
24 0.24
25 0.19
26 0.19
27 0.21
28 0.21
29 0.26
30 0.35
31 0.38
32 0.45
33 0.53
34 0.6
35 0.65
36 0.74
37 0.8
38 0.79
39 0.84
40 0.85
41 0.84
42 0.78
43 0.69
44 0.6
45 0.56
46 0.49
47 0.42
48 0.32
49 0.24
50 0.21
51 0.21
52 0.2
53 0.13
54 0.12
55 0.1
56 0.1
57 0.1
58 0.1
59 0.09
60 0.08
61 0.07
62 0.08
63 0.08
64 0.13
65 0.14
66 0.16
67 0.24
68 0.25
69 0.25
70 0.29
71 0.3
72 0.28
73 0.29
74 0.33
75 0.27
76 0.28
77 0.28
78 0.24
79 0.22
80 0.17
81 0.15
82 0.09
83 0.07
84 0.05
85 0.05
86 0.05
87 0.05
88 0.05
89 0.05
90 0.06