Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1X2HH31

Protein Details
Accession A0A1X2HH31    Localization Confidence Medium Confidence Score 10.2
NoLS Segment(s)
PositionSequenceProtein Nature
28-47QKRRAHRYRIQTNGNRSRHRBasic
NLS Segment(s)
Subcellular Location(s) nucl 14, mito 13
Family & Domain DBs
InterPro View protein in InterPro  
IPR000421  FA58C  
PROSITE View protein in PROSITE  
PS50022  FA58C_3  
Amino Acid Sequences MWIKIKINNRNYIETVVISSRSSFQQIQKRRAHRYRIQTNGNRSRHRLKSLEE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.37
2 0.32
3 0.23
4 0.2
5 0.15
6 0.14
7 0.13
8 0.12
9 0.15
10 0.16
11 0.21
12 0.29
13 0.36
14 0.44
15 0.5
16 0.57
17 0.63
18 0.68
19 0.71
20 0.69
21 0.73
22 0.73
23 0.74
24 0.77
25 0.75
26 0.78
27 0.8
28 0.81
29 0.76
30 0.73
31 0.74
32 0.71
33 0.71