Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1X2J0F3

Protein Details
Accession A0A1X2J0F3   
Localization Confidence High
Confidence Score 16.4
NoLS Segment(s)
PositionSequenceProtein Nature
144-184LAAKERKRKADEQKEWENTRETRVNSWRDFQKKKKKVKKSAHydrophilic
NLS Segment(s)
PositionSequence
140-153RKVELAAKERKRKA
174-184QKKKKKVKKSA
Subcellular Location(s) nucl 23.5, cyto_nucl 13.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR001623  DnaJ_domain  
IPR036869  J_dom_sf  
Pfam View protein in Pfam  
PF00226  DnaJ  
CDD cd06257  DnaJ  
Amino Acid Sequences MAYRKKSLMIHPDKVNHSDAQEAFAKLKKAESDLNDTTQLQFLLDLIQEAKVEILKGKGFEKIKMTTPGTIPTAAATTNEKTDTPTTSLSVVDDSAYPHLSTEQGRRDVQAKLKQLLIELELRRRRIIKRDLETEGAEARKVELAAKERKRKADEQKEWENTRETRVNSWRDFQKKKKKVKKSA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.63
2 0.58
3 0.49
4 0.41
5 0.4
6 0.33
7 0.3
8 0.29
9 0.27
10 0.26
11 0.27
12 0.28
13 0.22
14 0.25
15 0.23
16 0.23
17 0.27
18 0.29
19 0.34
20 0.34
21 0.37
22 0.36
23 0.35
24 0.32
25 0.28
26 0.24
27 0.15
28 0.12
29 0.09
30 0.08
31 0.08
32 0.07
33 0.06
34 0.07
35 0.07
36 0.07
37 0.07
38 0.06
39 0.07
40 0.07
41 0.09
42 0.09
43 0.11
44 0.12
45 0.18
46 0.19
47 0.21
48 0.24
49 0.25
50 0.28
51 0.32
52 0.33
53 0.29
54 0.29
55 0.29
56 0.26
57 0.24
58 0.2
59 0.14
60 0.13
61 0.11
62 0.11
63 0.1
64 0.09
65 0.1
66 0.11
67 0.11
68 0.12
69 0.14
70 0.14
71 0.14
72 0.14
73 0.14
74 0.13
75 0.13
76 0.12
77 0.11
78 0.09
79 0.07
80 0.06
81 0.06
82 0.07
83 0.07
84 0.07
85 0.06
86 0.07
87 0.08
88 0.09
89 0.14
90 0.17
91 0.21
92 0.21
93 0.22
94 0.25
95 0.27
96 0.32
97 0.34
98 0.34
99 0.31
100 0.33
101 0.32
102 0.3
103 0.27
104 0.22
105 0.21
106 0.19
107 0.26
108 0.28
109 0.29
110 0.31
111 0.34
112 0.36
113 0.39
114 0.46
115 0.47
116 0.5
117 0.54
118 0.56
119 0.55
120 0.52
121 0.45
122 0.4
123 0.31
124 0.24
125 0.18
126 0.15
127 0.14
128 0.13
129 0.13
130 0.14
131 0.2
132 0.3
133 0.39
134 0.48
135 0.52
136 0.59
137 0.63
138 0.68
139 0.73
140 0.74
141 0.75
142 0.74
143 0.79
144 0.81
145 0.78
146 0.72
147 0.67
148 0.57
149 0.54
150 0.52
151 0.44
152 0.44
153 0.49
154 0.53
155 0.51
156 0.57
157 0.6
158 0.63
159 0.71
160 0.73
161 0.76
162 0.78
163 0.86
164 0.89