Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1X2IQ10

Protein Details
Accession A0A1X2IQ10   
Localization Confidence Low
Confidence Score 8.4
NoLS Segment(s)
PositionSequenceProtein Nature
14-40IPKTRNTYCKGTKCRKHTPHKVTQYKAHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 12.5, cyto_nucl 11, mito 7, cyto 6.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR000552  Ribosomal_L44e  
IPR011332  Ribosomal_zn-bd  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00935  Ribosomal_L44  
PROSITE View protein in PROSITE  
PS01172  RIBOSOMAL_L44E  
Amino Acid Sequences MESSSIDVYDIVNIPKTRNTYCKGTKCRKHTPHKVTQYKAGKASLFAQGKRRYDRKQSGYGGQTKPVFHKKAKTTKKIVLRLECTKCKYKMQLPIKRCKHFELGGDKKTKGAALVF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.19
2 0.23
3 0.27
4 0.29
5 0.34
6 0.37
7 0.41
8 0.5
9 0.59
10 0.64
11 0.71
12 0.75
13 0.77
14 0.84
15 0.85
16 0.86
17 0.87
18 0.86
19 0.86
20 0.88
21 0.88
22 0.8
23 0.79
24 0.76
25 0.69
26 0.63
27 0.54
28 0.44
29 0.36
30 0.35
31 0.34
32 0.29
33 0.27
34 0.32
35 0.36
36 0.4
37 0.45
38 0.49
39 0.45
40 0.52
41 0.59
42 0.56
43 0.58
44 0.56
45 0.56
46 0.54
47 0.57
48 0.48
49 0.43
50 0.4
51 0.33
52 0.35
53 0.37
54 0.36
55 0.31
56 0.38
57 0.43
58 0.51
59 0.6
60 0.63
61 0.62
62 0.66
63 0.73
64 0.73
65 0.72
66 0.69
67 0.66
68 0.67
69 0.68
70 0.67
71 0.63
72 0.62
73 0.58
74 0.56
75 0.56
76 0.54
77 0.57
78 0.61
79 0.66
80 0.66
81 0.74
82 0.78
83 0.79
84 0.75
85 0.69
86 0.66
87 0.6
88 0.6
89 0.6
90 0.59
91 0.6
92 0.62
93 0.57
94 0.51
95 0.49
96 0.42