Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1X2I1H3

Protein Details
Accession A0A1X2I1H3    Localization Confidence Medium Confidence Score 12.1
NoLS Segment(s)
PositionSequenceProtein Nature
1-26KDLPPRPSKQCLPPQPPPKRPPPTTPHydrophilic
119-145KVSPHNPPKKTSPHNPQKKTSPHDPSKHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 17.5, cyto_nucl 11, mito 6
Family & Domain DBs
Amino Acid Sequences KDLPPRPSKQCLPPQPPPKRPPPTTPKIMSPPTTPQNSVSPHNPQNSVSPHNPQIRSPPYTPQIRSPPIHSQNKVSPIHPPNNLPPYTPHIRSPPTIPQIVSPPYTPHIRSPPIHPPYKVSPHNPPKKTSPHNPQKKTSPHDPSK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.82
2 0.84
3 0.87
4 0.84
5 0.84
6 0.83
7 0.8
8 0.8
9 0.79
10 0.76
11 0.76
12 0.73
13 0.69
14 0.67
15 0.67
16 0.6
17 0.54
18 0.54
19 0.51
20 0.51
21 0.45
22 0.4
23 0.4
24 0.41
25 0.4
26 0.37
27 0.38
28 0.4
29 0.42
30 0.41
31 0.36
32 0.38
33 0.39
34 0.4
35 0.35
36 0.34
37 0.38
38 0.43
39 0.43
40 0.38
41 0.42
42 0.41
43 0.44
44 0.4
45 0.39
46 0.38
47 0.43
48 0.43
49 0.41
50 0.43
51 0.43
52 0.43
53 0.42
54 0.46
55 0.49
56 0.54
57 0.48
58 0.45
59 0.44
60 0.51
61 0.47
62 0.38
63 0.37
64 0.35
65 0.39
66 0.37
67 0.36
68 0.34
69 0.39
70 0.39
71 0.32
72 0.3
73 0.31
74 0.35
75 0.34
76 0.31
77 0.29
78 0.32
79 0.32
80 0.34
81 0.36
82 0.35
83 0.35
84 0.32
85 0.29
86 0.32
87 0.33
88 0.3
89 0.22
90 0.21
91 0.22
92 0.26
93 0.25
94 0.26
95 0.3
96 0.34
97 0.35
98 0.39
99 0.46
100 0.5
101 0.54
102 0.49
103 0.48
104 0.51
105 0.58
106 0.59
107 0.54
108 0.58
109 0.63
110 0.73
111 0.71
112 0.68
113 0.66
114 0.7
115 0.73
116 0.73
117 0.73
118 0.74
119 0.81
120 0.84
121 0.83
122 0.83
123 0.84
124 0.81
125 0.8