Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1X2I721

Protein Details
Accession A0A1X2I721    Localization Confidence Medium Confidence Score 14.3
NoLS Segment(s)
PositionSequenceProtein Nature
144-166EVSITLLQKKKKKRIDLTLIPLIHydrophilic
NLS Segment(s)
PositionSequence
153-156KKKK
Subcellular Location(s) nucl 23.5, mito_nucl 14
Family & Domain DBs
InterPro View protein in InterPro  
IPR007201  Mei2-like_Rrm_C  
IPR035979  RBD_domain_sf  
Gene Ontology GO:0003676  F:nucleic acid binding  
Pfam View protein in Pfam  
PF04059  RRM_2  
Amino Acid Sequences MICERDYQFDVNNVINGLDNRTTFMIRNIPNKYTQAMLMECIDSTHKGTYDFLYLRIDFKHKCNVGYAFINFINARSVISFFEQKAGKLWSRFNSEKKCELSYAKIQGKVNLINKFRNSVVMEQDLSYRPKIFYSYGPRKGEEEVSITLLQKKKKKRIDLTLIPLI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.18
2 0.19
3 0.17
4 0.17
5 0.17
6 0.16
7 0.17
8 0.18
9 0.19
10 0.18
11 0.21
12 0.25
13 0.27
14 0.35
15 0.37
16 0.38
17 0.4
18 0.41
19 0.39
20 0.32
21 0.29
22 0.24
23 0.21
24 0.2
25 0.17
26 0.16
27 0.14
28 0.13
29 0.14
30 0.11
31 0.12
32 0.12
33 0.11
34 0.12
35 0.13
36 0.14
37 0.18
38 0.17
39 0.17
40 0.19
41 0.19
42 0.19
43 0.19
44 0.22
45 0.19
46 0.21
47 0.29
48 0.27
49 0.27
50 0.29
51 0.29
52 0.29
53 0.3
54 0.27
55 0.21
56 0.2
57 0.21
58 0.17
59 0.16
60 0.13
61 0.1
62 0.1
63 0.07
64 0.08
65 0.07
66 0.09
67 0.1
68 0.09
69 0.14
70 0.14
71 0.14
72 0.15
73 0.17
74 0.18
75 0.18
76 0.22
77 0.21
78 0.29
79 0.33
80 0.38
81 0.43
82 0.45
83 0.49
84 0.48
85 0.46
86 0.41
87 0.39
88 0.37
89 0.34
90 0.39
91 0.37
92 0.4
93 0.39
94 0.39
95 0.4
96 0.41
97 0.41
98 0.4
99 0.39
100 0.39
101 0.39
102 0.39
103 0.36
104 0.35
105 0.31
106 0.26
107 0.27
108 0.25
109 0.25
110 0.23
111 0.25
112 0.23
113 0.23
114 0.22
115 0.2
116 0.17
117 0.18
118 0.2
119 0.19
120 0.24
121 0.32
122 0.41
123 0.49
124 0.52
125 0.52
126 0.52
127 0.52
128 0.48
129 0.39
130 0.33
131 0.25
132 0.26
133 0.26
134 0.26
135 0.29
136 0.31
137 0.36
138 0.4
139 0.48
140 0.55
141 0.63
142 0.72
143 0.76
144 0.82
145 0.85
146 0.87