Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1X2IXE2

Protein Details
Accession A0A1X2IXE2    Localization Confidence Medium Confidence Score 10.1
NoLS Segment(s)
PositionSequenceProtein Nature
74-96SDQLTRRKKAMYRTYVRRRPLETHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 20.5, cyto_nucl 14.5, cyto 5.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR028133  Dynamitin  
Gene Ontology GO:0005737  C:cytoplasm  
GO:0005869  C:dynactin complex  
GO:0007017  P:microtubule-based process  
Pfam View protein in Pfam  
PF04912  Dynamitin  
Amino Acid Sequences MSKYATLPDIDDQPDVYETSDDIEQAQHYTNDNDDDLSNDNGDSEHLDRARISHQEASDRFRNSVVDSNNTDFSDQLTRRKKAMYRTYVRRRPLETNEYEILPKEMELEETQLQKFRRLTFEVQELSQALDNEKDDEEKSKDDKAISHAELVSQITYLQNDLGRLHHRIMDSDSSPLDHGQSGTATTYGKRVDEAKSLIKQLEAYKAMASSPSPNPDDPATATTTNETKDTNGDVVTYELYYTPETIKAQQQGRVVDIDDRIAKIEKLVGTSSGQGFDSIPPNFTTTSLIHSLSKLEQQITLLAQPRHLDTVARRIKVLNSELDRLHELKSGGNTGPTGRKDLGYGGLSGLPGSTTTTSASVAAGGLGDNNKDDQHGLSNDAEEKVTHLFATMEKVDPLLNLTPALLTRLKALQGLHTEAATFGRSVKVISEEQTRMTEEIKSLDTTCELLTKSLKDNEDLINKNVGVIDSRMTDLVQRMEALASTSIPPSS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.23
2 0.21
3 0.18
4 0.13
5 0.11
6 0.14
7 0.14
8 0.12
9 0.11
10 0.12
11 0.12
12 0.14
13 0.16
14 0.15
15 0.17
16 0.18
17 0.2
18 0.21
19 0.21
20 0.2
21 0.18
22 0.18
23 0.19
24 0.18
25 0.17
26 0.14
27 0.14
28 0.12
29 0.13
30 0.14
31 0.13
32 0.17
33 0.17
34 0.18
35 0.18
36 0.21
37 0.25
38 0.25
39 0.27
40 0.27
41 0.29
42 0.37
43 0.39
44 0.44
45 0.46
46 0.45
47 0.42
48 0.37
49 0.37
50 0.31
51 0.36
52 0.32
53 0.32
54 0.34
55 0.36
56 0.38
57 0.37
58 0.34
59 0.27
60 0.26
61 0.29
62 0.27
63 0.33
64 0.39
65 0.41
66 0.43
67 0.5
68 0.52
69 0.53
70 0.61
71 0.62
72 0.63
73 0.72
74 0.8
75 0.82
76 0.84
77 0.8
78 0.75
79 0.73
80 0.71
81 0.7
82 0.62
83 0.61
84 0.56
85 0.51
86 0.46
87 0.39
88 0.31
89 0.22
90 0.18
91 0.13
92 0.11
93 0.12
94 0.12
95 0.15
96 0.17
97 0.2
98 0.21
99 0.24
100 0.24
101 0.28
102 0.31
103 0.3
104 0.33
105 0.34
106 0.38
107 0.38
108 0.44
109 0.4
110 0.37
111 0.35
112 0.3
113 0.26
114 0.23
115 0.19
116 0.13
117 0.13
118 0.13
119 0.13
120 0.13
121 0.14
122 0.13
123 0.17
124 0.18
125 0.2
126 0.23
127 0.24
128 0.26
129 0.26
130 0.27
131 0.27
132 0.32
133 0.28
134 0.29
135 0.25
136 0.23
137 0.23
138 0.22
139 0.17
140 0.1
141 0.1
142 0.08
143 0.08
144 0.08
145 0.08
146 0.08
147 0.09
148 0.1
149 0.12
150 0.15
151 0.17
152 0.18
153 0.2
154 0.19
155 0.19
156 0.22
157 0.23
158 0.2
159 0.2
160 0.19
161 0.16
162 0.17
163 0.16
164 0.13
165 0.1
166 0.09
167 0.08
168 0.08
169 0.08
170 0.08
171 0.08
172 0.08
173 0.07
174 0.1
175 0.11
176 0.1
177 0.11
178 0.13
179 0.15
180 0.18
181 0.21
182 0.23
183 0.25
184 0.26
185 0.25
186 0.23
187 0.23
188 0.21
189 0.23
190 0.2
191 0.18
192 0.17
193 0.17
194 0.16
195 0.15
196 0.13
197 0.12
198 0.12
199 0.16
200 0.17
201 0.17
202 0.19
203 0.19
204 0.2
205 0.17
206 0.17
207 0.16
208 0.14
209 0.15
210 0.14
211 0.15
212 0.14
213 0.14
214 0.12
215 0.09
216 0.1
217 0.11
218 0.1
219 0.09
220 0.09
221 0.08
222 0.08
223 0.08
224 0.07
225 0.06
226 0.05
227 0.06
228 0.06
229 0.07
230 0.07
231 0.08
232 0.09
233 0.11
234 0.14
235 0.19
236 0.2
237 0.24
238 0.26
239 0.25
240 0.25
241 0.24
242 0.21
243 0.18
244 0.16
245 0.13
246 0.11
247 0.1
248 0.11
249 0.11
250 0.1
251 0.08
252 0.11
253 0.09
254 0.1
255 0.1
256 0.1
257 0.11
258 0.12
259 0.13
260 0.11
261 0.1
262 0.09
263 0.1
264 0.1
265 0.14
266 0.12
267 0.13
268 0.13
269 0.14
270 0.14
271 0.14
272 0.15
273 0.12
274 0.15
275 0.16
276 0.16
277 0.16
278 0.16
279 0.17
280 0.15
281 0.17
282 0.15
283 0.14
284 0.13
285 0.13
286 0.14
287 0.13
288 0.15
289 0.17
290 0.16
291 0.17
292 0.17
293 0.18
294 0.18
295 0.18
296 0.17
297 0.13
298 0.23
299 0.28
300 0.28
301 0.27
302 0.27
303 0.29
304 0.32
305 0.33
306 0.29
307 0.26
308 0.29
309 0.28
310 0.3
311 0.3
312 0.26
313 0.25
314 0.21
315 0.18
316 0.17
317 0.18
318 0.19
319 0.16
320 0.16
321 0.15
322 0.15
323 0.21
324 0.2
325 0.22
326 0.2
327 0.2
328 0.2
329 0.21
330 0.23
331 0.17
332 0.17
333 0.14
334 0.14
335 0.13
336 0.12
337 0.11
338 0.07
339 0.06
340 0.07
341 0.07
342 0.07
343 0.08
344 0.09
345 0.09
346 0.1
347 0.09
348 0.08
349 0.07
350 0.06
351 0.05
352 0.05
353 0.05
354 0.06
355 0.06
356 0.07
357 0.08
358 0.08
359 0.08
360 0.09
361 0.09
362 0.13
363 0.14
364 0.17
365 0.17
366 0.18
367 0.2
368 0.2
369 0.19
370 0.14
371 0.14
372 0.13
373 0.13
374 0.11
375 0.09
376 0.09
377 0.1
378 0.15
379 0.15
380 0.14
381 0.14
382 0.15
383 0.14
384 0.14
385 0.16
386 0.13
387 0.12
388 0.11
389 0.11
390 0.11
391 0.11
392 0.15
393 0.13
394 0.11
395 0.13
396 0.16
397 0.16
398 0.18
399 0.19
400 0.2
401 0.23
402 0.27
403 0.25
404 0.23
405 0.22
406 0.2
407 0.21
408 0.16
409 0.12
410 0.09
411 0.1
412 0.1
413 0.11
414 0.12
415 0.15
416 0.16
417 0.19
418 0.26
419 0.26
420 0.28
421 0.3
422 0.3
423 0.27
424 0.26
425 0.25
426 0.19
427 0.2
428 0.2
429 0.2
430 0.19
431 0.19
432 0.19
433 0.18
434 0.17
435 0.18
436 0.17
437 0.17
438 0.2
439 0.22
440 0.27
441 0.32
442 0.33
443 0.31
444 0.34
445 0.39
446 0.44
447 0.44
448 0.41
449 0.4
450 0.38
451 0.37
452 0.34
453 0.28
454 0.21
455 0.19
456 0.18
457 0.15
458 0.16
459 0.16
460 0.15
461 0.18
462 0.19
463 0.2
464 0.19
465 0.18
466 0.17
467 0.17
468 0.17
469 0.17
470 0.14
471 0.13
472 0.13