Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1X2IF13

Protein Details
Accession A0A1X2IF13    Localization Confidence Medium Confidence Score 14.2
NoLS Segment(s)
PositionSequenceProtein Nature
8-34PAKTTEKKTKTDIKKRKSSRKESYASYHydrophilic
NLS Segment(s)
PositionSequence
8-28PAKTTEKKTKTDIKKRKSSRK
Subcellular Location(s) nucl 23, cyto_nucl 14
Family & Domain DBs
InterPro View protein in InterPro  
IPR009072  Histone-fold  
IPR007125  Histone_H2A/H2B/H3  
IPR000558  Histone_H2B  
Gene Ontology GO:0000786  C:nucleosome  
GO:0005634  C:nucleus  
GO:0003677  F:DNA binding  
GO:0046982  F:protein heterodimerization activity  
GO:0030527  F:structural constituent of chromatin  
Pfam View protein in Pfam  
PF00125  Histone  
PROSITE View protein in PROSITE  
PS00357  HISTONE_H2B  
Amino Acid Sequences MAPAGKAPAKTTEKKTKTDIKKRKSSRKESYASYIYKVLKQVHPDTGISNKAMSILNSFVNDIFERIASEASKLAAYNKRSTISSREIQTSVRLILPGELAKHAVSEGTKAVTKYTSSK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.6
2 0.65
3 0.66
4 0.7
5 0.75
6 0.76
7 0.75
8 0.81
9 0.87
10 0.91
11 0.91
12 0.9
13 0.9
14 0.89
15 0.84
16 0.78
17 0.75
18 0.71
19 0.62
20 0.53
21 0.48
22 0.4
23 0.37
24 0.37
25 0.33
26 0.29
27 0.33
28 0.34
29 0.32
30 0.33
31 0.31
32 0.28
33 0.27
34 0.26
35 0.21
36 0.18
37 0.13
38 0.13
39 0.13
40 0.11
41 0.09
42 0.09
43 0.1
44 0.1
45 0.1
46 0.08
47 0.09
48 0.09
49 0.08
50 0.07
51 0.06
52 0.06
53 0.06
54 0.07
55 0.06
56 0.07
57 0.07
58 0.07
59 0.07
60 0.07
61 0.11
62 0.16
63 0.19
64 0.22
65 0.24
66 0.26
67 0.26
68 0.29
69 0.3
70 0.31
71 0.33
72 0.32
73 0.33
74 0.32
75 0.32
76 0.33
77 0.29
78 0.24
79 0.2
80 0.17
81 0.14
82 0.14
83 0.15
84 0.14
85 0.13
86 0.12
87 0.13
88 0.12
89 0.12
90 0.11
91 0.11
92 0.1
93 0.11
94 0.11
95 0.13
96 0.16
97 0.16
98 0.18
99 0.18