Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1X2IJ69

Protein Details
Accession A0A1X2IJ69    Localization Confidence Medium Confidence Score 11.2
NoLS Segment(s)
PositionSequenceProtein Nature
95-119MMDYKEEKPVRPRKPRTSRVKEEENBasic
NLS Segment(s)
PositionSequence
105-110RPRKPR
Subcellular Location(s) nucl 11.5, cyto_nucl 10, cyto 7.5, mito 7
Family & Domain DBs
InterPro View protein in InterPro  
IPR003958  CBFA_NFYB_domain  
IPR009072  Histone-fold  
Gene Ontology GO:0046982  F:protein heterodimerization activity  
Pfam View protein in Pfam  
PF00808  CBFD_NFYB_HMF  
Amino Acid Sequences MKKKYKTKFPVARIKKIMQLDEDVGKVAQATPILISKALELFMQSLIDQACNEARSRSAKRLTVAHLKKTIDTTEQFDFLKDIVANVPDPTDTPMMDYKEEKPVRPRKPRTSRVKEEEN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.76
2 0.72
3 0.67
4 0.6
5 0.51
6 0.46
7 0.39
8 0.35
9 0.32
10 0.25
11 0.2
12 0.17
13 0.15
14 0.11
15 0.09
16 0.07
17 0.07
18 0.07
19 0.09
20 0.09
21 0.09
22 0.09
23 0.08
24 0.09
25 0.09
26 0.08
27 0.07
28 0.07
29 0.07
30 0.07
31 0.06
32 0.07
33 0.07
34 0.07
35 0.07
36 0.07
37 0.08
38 0.08
39 0.09
40 0.08
41 0.1
42 0.15
43 0.18
44 0.23
45 0.26
46 0.28
47 0.29
48 0.32
49 0.35
50 0.39
51 0.39
52 0.38
53 0.39
54 0.37
55 0.36
56 0.35
57 0.32
58 0.25
59 0.24
60 0.23
61 0.19
62 0.21
63 0.2
64 0.18
65 0.18
66 0.14
67 0.15
68 0.1
69 0.09
70 0.09
71 0.1
72 0.1
73 0.1
74 0.1
75 0.08
76 0.09
77 0.11
78 0.11
79 0.1
80 0.12
81 0.16
82 0.18
83 0.2
84 0.22
85 0.22
86 0.31
87 0.34
88 0.35
89 0.41
90 0.49
91 0.57
92 0.66
93 0.74
94 0.74
95 0.83
96 0.9
97 0.91
98 0.92
99 0.92