Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1X2J1D2

Protein Details
Accession A0A1X2J1D2   
Localization Confidence High
Confidence Score 15.1
NoLS Segment(s)
PositionSequenceProtein Nature
40-77IHPPKKTPPIHPQKRPPPYTPKKRSPPYTPQKRPPPIHBasic
95-114YTPKKRSPPYTPKRDLPPYTHydrophilic
NLS Segment(s)
PositionSequence
32-103TPKIKSPPIHPPKKTPPIHPQKRPPPYTPKKRSPPYTPQKRPPPIHPQKETSPHTPPKKGLPPYTPKKRSPP
Subcellular Location(s) nucl 18.5, cyto_nucl 10, mito 8
Family & Domain DBs
Amino Acid Sequences LPPQPPKKDLPITPPKKDLPPYTPKRDLPPYTPKIKSPPIHPPKKTPPIHPQKRPPPYTPKKRSPPYTPQKRPPPIHPQKETSPHTPPKKGLPPYTPKKRSPPYTPKRDLPPYTPKIMSPPYTPKKSLPHTPPK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.69
2 0.65
3 0.63
4 0.65
5 0.62
6 0.59
7 0.61
8 0.64
9 0.66
10 0.7
11 0.66
12 0.67
13 0.7
14 0.66
15 0.62
16 0.64
17 0.61
18 0.61
19 0.61
20 0.57
21 0.54
22 0.59
23 0.54
24 0.5
25 0.55
26 0.57
27 0.64
28 0.64
29 0.66
30 0.67
31 0.74
32 0.72
33 0.68
34 0.68
35 0.7
36 0.77
37 0.77
38 0.77
39 0.77
40 0.83
41 0.8
42 0.75
43 0.75
44 0.76
45 0.78
46 0.77
47 0.77
48 0.77
49 0.79
50 0.8
51 0.77
52 0.77
53 0.77
54 0.79
55 0.77
56 0.77
57 0.79
58 0.82
59 0.77
60 0.73
61 0.74
62 0.73
63 0.74
64 0.69
65 0.64
66 0.61
67 0.66
68 0.64
69 0.58
70 0.56
71 0.55
72 0.57
73 0.56
74 0.52
75 0.52
76 0.56
77 0.57
78 0.55
79 0.54
80 0.58
81 0.65
82 0.74
83 0.73
84 0.69
85 0.73
86 0.75
87 0.73
88 0.73
89 0.74
90 0.74
91 0.77
92 0.79
93 0.76
94 0.77
95 0.8
96 0.74
97 0.7
98 0.7
99 0.64
100 0.63
101 0.58
102 0.5
103 0.47
104 0.49
105 0.45
106 0.41
107 0.47
108 0.5
109 0.56
110 0.58
111 0.57
112 0.61
113 0.64
114 0.68