Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1X2IJY6

Protein Details
Accession A0A1X2IJY6    Localization Confidence Low Confidence Score 8.3
NoLS Segment(s)
PositionSequenceProtein Nature
93-115TQACYRTPRCSLKPKKNSTASSSHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 10.5, mito 9, cyto_nucl 8, cyto 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR010347  Tdp1  
Gene Ontology GO:0005634  C:nucleus  
GO:0008081  F:phosphoric diester hydrolase activity  
GO:0006281  P:DNA repair  
Pfam View protein in Pfam  
PF06087  Tyr-DNA_phospho  
Amino Acid Sequences MDLTYLMSHLHPHILTKGKAPLIVVYGSTDADVAKQVTKEYPWVRLIKPKLFDRYGSHHTKAMLLFFNTKGIKTAQIVVMTANMVQDDWEQMTQACYRTPRCSLKPKKNSTASSSSPVSGSIQGVEFGSPFERDMCNYLRGYDLPALNEVAHRLRFYDWSPCKAILVGSIPGRHKQQARNSWGMLRLAQVLQDHVQLPEQCCKESSIVIQCSSIASLTQRFLDALEQCLSSANNSKDAHNITMNLVYPSMDTVAQSVTGLSQSGGFLRLDEDVYEKQRPWFEKHMKEWTSHTVGRQQLMPHIKTFTRIYLDTNTNKYALAWVFLTSHNLSRAAWGDLQLNGSQLYIKSYELGVLLCPSLWETQTDSYVEMMPSNLFDPSPCNLPGIPIVPVRLPYDLPLNNQTSPCFVRRPYY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.31
2 0.32
3 0.34
4 0.4
5 0.37
6 0.38
7 0.36
8 0.32
9 0.28
10 0.27
11 0.23
12 0.18
13 0.17
14 0.16
15 0.15
16 0.13
17 0.1
18 0.09
19 0.11
20 0.11
21 0.13
22 0.13
23 0.15
24 0.18
25 0.19
26 0.27
27 0.28
28 0.33
29 0.37
30 0.42
31 0.43
32 0.5
33 0.56
34 0.54
35 0.59
36 0.59
37 0.61
38 0.58
39 0.59
40 0.56
41 0.57
42 0.58
43 0.58
44 0.53
45 0.48
46 0.46
47 0.46
48 0.41
49 0.37
50 0.32
51 0.27
52 0.28
53 0.26
54 0.32
55 0.28
56 0.27
57 0.25
58 0.23
59 0.23
60 0.22
61 0.25
62 0.22
63 0.22
64 0.22
65 0.2
66 0.19
67 0.16
68 0.15
69 0.11
70 0.08
71 0.06
72 0.07
73 0.07
74 0.08
75 0.09
76 0.09
77 0.09
78 0.09
79 0.12
80 0.13
81 0.14
82 0.15
83 0.18
84 0.22
85 0.26
86 0.33
87 0.4
88 0.45
89 0.55
90 0.63
91 0.69
92 0.76
93 0.81
94 0.83
95 0.83
96 0.81
97 0.77
98 0.73
99 0.66
100 0.6
101 0.53
102 0.44
103 0.35
104 0.32
105 0.26
106 0.2
107 0.17
108 0.12
109 0.11
110 0.1
111 0.11
112 0.1
113 0.08
114 0.07
115 0.08
116 0.07
117 0.07
118 0.09
119 0.09
120 0.1
121 0.13
122 0.16
123 0.18
124 0.18
125 0.18
126 0.18
127 0.17
128 0.2
129 0.2
130 0.18
131 0.16
132 0.16
133 0.16
134 0.15
135 0.15
136 0.14
137 0.12
138 0.12
139 0.12
140 0.12
141 0.12
142 0.14
143 0.16
144 0.24
145 0.25
146 0.28
147 0.3
148 0.29
149 0.28
150 0.26
151 0.25
152 0.16
153 0.16
154 0.14
155 0.13
156 0.17
157 0.18
158 0.2
159 0.22
160 0.25
161 0.27
162 0.32
163 0.39
164 0.44
165 0.49
166 0.51
167 0.5
168 0.48
169 0.46
170 0.4
171 0.31
172 0.23
173 0.18
174 0.14
175 0.14
176 0.12
177 0.1
178 0.1
179 0.11
180 0.11
181 0.09
182 0.12
183 0.12
184 0.14
185 0.19
186 0.19
187 0.17
188 0.18
189 0.19
190 0.17
191 0.16
192 0.18
193 0.18
194 0.19
195 0.19
196 0.18
197 0.17
198 0.16
199 0.15
200 0.12
201 0.06
202 0.06
203 0.07
204 0.07
205 0.08
206 0.08
207 0.08
208 0.08
209 0.11
210 0.1
211 0.11
212 0.12
213 0.11
214 0.11
215 0.12
216 0.11
217 0.1
218 0.15
219 0.14
220 0.19
221 0.2
222 0.21
223 0.23
224 0.25
225 0.26
226 0.21
227 0.21
228 0.16
229 0.17
230 0.17
231 0.14
232 0.12
233 0.1
234 0.09
235 0.08
236 0.08
237 0.06
238 0.06
239 0.06
240 0.06
241 0.06
242 0.06
243 0.05
244 0.05
245 0.05
246 0.05
247 0.04
248 0.05
249 0.05
250 0.05
251 0.07
252 0.07
253 0.07
254 0.07
255 0.08
256 0.08
257 0.08
258 0.11
259 0.12
260 0.16
261 0.18
262 0.18
263 0.21
264 0.25
265 0.28
266 0.31
267 0.39
268 0.44
269 0.5
270 0.56
271 0.63
272 0.6
273 0.58
274 0.56
275 0.52
276 0.5
277 0.43
278 0.39
279 0.36
280 0.37
281 0.36
282 0.35
283 0.29
284 0.3
285 0.36
286 0.35
287 0.3
288 0.31
289 0.3
290 0.31
291 0.32
292 0.28
293 0.25
294 0.25
295 0.26
296 0.29
297 0.35
298 0.36
299 0.39
300 0.36
301 0.33
302 0.32
303 0.29
304 0.27
305 0.2
306 0.17
307 0.14
308 0.13
309 0.15
310 0.15
311 0.19
312 0.16
313 0.19
314 0.19
315 0.19
316 0.18
317 0.19
318 0.2
319 0.19
320 0.18
321 0.17
322 0.17
323 0.18
324 0.2
325 0.17
326 0.16
327 0.13
328 0.13
329 0.12
330 0.11
331 0.12
332 0.11
333 0.11
334 0.11
335 0.11
336 0.12
337 0.12
338 0.12
339 0.1
340 0.1
341 0.1
342 0.09
343 0.09
344 0.09
345 0.1
346 0.11
347 0.11
348 0.14
349 0.16
350 0.19
351 0.19
352 0.18
353 0.18
354 0.2
355 0.18
356 0.15
357 0.14
358 0.12
359 0.12
360 0.12
361 0.11
362 0.09
363 0.09
364 0.13
365 0.14
366 0.18
367 0.18
368 0.19
369 0.18
370 0.21
371 0.24
372 0.22
373 0.23
374 0.21
375 0.22
376 0.22
377 0.24
378 0.24
379 0.23
380 0.21
381 0.2
382 0.27
383 0.28
384 0.31
385 0.36
386 0.38
387 0.39
388 0.4
389 0.39
390 0.37
391 0.39
392 0.38
393 0.36