Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1X2ICG1

Protein Details
Accession A0A1X2ICG1    Localization Confidence Low Confidence Score 9.1
NoLS Segment(s)
PositionSequenceProtein Nature
96-129GLAEPGKGGRKQRKEKKNRAKKFRGTKKAAASGGBasic
NLS Segment(s)
PositionSequence
93-131ARVGLAEPGKGGRKQRKEKKNRAKKFRGTKKAAASGGKK
Subcellular Location(s) mito 19, cyto 4.5, cyto_nucl 4.5, nucl 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR012678  Ribosomal_L23/L15e_core_dom_sf  
IPR001976  Ribosomal_S24e  
IPR018098  Ribosomal_S24e_CS  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01282  Ribosomal_S24e  
PROSITE View protein in PROSITE  
PS00529  RIBOSOMAL_S24E  
Amino Acid Sequences MADASVTIRTRKFITNRLLQRKQMVVDVIHPGLANLSREEIREKLGKMYKTNKDVVSVFGFKTHFGGGRTTGFGLVYDNVEALKKFEPKYRLARVGLAEPGKGGRKQRKEKKNRAKKFRGTKKAAASGGKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.44
2 0.51
3 0.61
4 0.69
5 0.72
6 0.68
7 0.68
8 0.64
9 0.57
10 0.5
11 0.42
12 0.33
13 0.29
14 0.3
15 0.24
16 0.21
17 0.19
18 0.16
19 0.14
20 0.15
21 0.13
22 0.09
23 0.11
24 0.11
25 0.12
26 0.15
27 0.15
28 0.16
29 0.19
30 0.19
31 0.24
32 0.29
33 0.31
34 0.34
35 0.42
36 0.45
37 0.46
38 0.49
39 0.43
40 0.4
41 0.38
42 0.35
43 0.31
44 0.25
45 0.21
46 0.19
47 0.19
48 0.16
49 0.17
50 0.14
51 0.12
52 0.11
53 0.12
54 0.11
55 0.12
56 0.12
57 0.11
58 0.11
59 0.09
60 0.08
61 0.08
62 0.07
63 0.07
64 0.06
65 0.06
66 0.06
67 0.06
68 0.06
69 0.07
70 0.1
71 0.14
72 0.15
73 0.21
74 0.25
75 0.3
76 0.38
77 0.44
78 0.46
79 0.44
80 0.45
81 0.42
82 0.41
83 0.41
84 0.33
85 0.26
86 0.2
87 0.22
88 0.22
89 0.24
90 0.29
91 0.34
92 0.44
93 0.55
94 0.65
95 0.73
96 0.81
97 0.89
98 0.92
99 0.94
100 0.94
101 0.94
102 0.94
103 0.94
104 0.94
105 0.94
106 0.93
107 0.9
108 0.88
109 0.86
110 0.84
111 0.79