Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1X2IYY9

Protein Details
Accession A0A1X2IYY9    Localization Confidence Low Confidence Score 9.6
NoLS Segment(s)
PositionSequenceProtein Nature
69-102QLTSTLRKRRLKMNKHKHKKLRKRTRALRKRLGKBasic
NLS Segment(s)
PositionSequence
75-102RKRRLKMNKHKHKKLRKRTRALRKRLGK
Subcellular Location(s) mito 21, nucl 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR013177  COX24_C  
Pfam View protein in Pfam  
PF08213  COX24_C  
Amino Acid Sequences MTVRWASVNSTMHAQPTTAPVLPWNATVKPTVVNDSLTAYFATLRPFSAPPSPTLQQPIPSPLVEEGMQLTSTLRKRRLKMNKHKHKKLRKRTRALRKRLGK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.23
2 0.17
3 0.18
4 0.21
5 0.17
6 0.16
7 0.15
8 0.19
9 0.19
10 0.21
11 0.2
12 0.17
13 0.18
14 0.19
15 0.18
16 0.17
17 0.18
18 0.19
19 0.17
20 0.16
21 0.16
22 0.18
23 0.17
24 0.15
25 0.14
26 0.1
27 0.1
28 0.1
29 0.12
30 0.09
31 0.09
32 0.1
33 0.11
34 0.13
35 0.16
36 0.16
37 0.16
38 0.21
39 0.22
40 0.21
41 0.24
42 0.23
43 0.21
44 0.21
45 0.23
46 0.19
47 0.18
48 0.19
49 0.15
50 0.16
51 0.14
52 0.13
53 0.1
54 0.09
55 0.09
56 0.08
57 0.08
58 0.12
59 0.17
60 0.23
61 0.3
62 0.36
63 0.39
64 0.5
65 0.6
66 0.66
67 0.73
68 0.78
69 0.81
70 0.86
71 0.94
72 0.94
73 0.95
74 0.95
75 0.95
76 0.95
77 0.95
78 0.95
79 0.95
80 0.96
81 0.95
82 0.94